Phospho-RAC1-S71 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Goat Polyclonal Anti-CAV1 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli. |
Rabbit Monoclonal Antibody against CASP3 (Clone E87)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DAF Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF. |
Rabbit anti-CYCS Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYCS |
CD55 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD55 |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CASP3 |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP3 |
CD86 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD86 |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal anti-SGCA antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SGCA. |
Anti-RAC2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
PRF1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRF1 |
Rabbit Polyclonal Caspase-8 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A. |
Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCND1 |
Rabbit anti-ITGB2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-MYH9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |
Goat Polyclonal Anti-ICAM1 (aa313-327) Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ICAM1 (aa313-327) Antibody: Peptide with sequence C-PNVILTKPEVSEGTE, from the internal region of the protein sequence according to NP_000192.2. |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Goat Polyclonal Antibody against Caveolin 1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2. |
Rabbit anti-ITGAL Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human ITGAL |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
Modifications | Phospho-specific |
BID Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BID |
Rabbit Polyclonal Anti-PRF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Rabbit Polyclonal Coxsackie Adenovirus Receptor Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal Caspase 8 (Tyr380) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 8 around the phosphorylation site of tyrosine 380 (Q-P-YP-L-E). |
Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
Modifications | Phospho-specific |
Anti-CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal CASP9 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Rabbit Polyclonal Caspase 8 (Ser347) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 around the phosphorylation site of Serine 347 |
Modifications | Phospho-specific |
Rabbit polyclonal Caveolin-1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caveolin-1. |
Rabbit anti-CXADR Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CXADR |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-MYH10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYH10 antibody: synthetic peptide directed towards the N terminal of human MYH10. Synthetic peptide located within the following region: WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD |
Rabbit Polyclonal Anti-Caveolin-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caveolin-1 Antibody: A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Anti-Caveolin 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caveolin 1 Antibody: A synthesized peptide derived from human Caveolin 1 |
Rabbit Monoclonal Antibody against ITGB2 (Clone EP1286Y)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against FYN
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence VQCKDKEATKLTE, from the N Terminus of the protein sequence according to NP_002028.1; NP_694592.1; NP_694593.1. |