Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-MMP-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
Rabbit Polyclonal Anti-MMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP1 Antibody: A synthesized peptide derived from human MMP1 |
Rabbit anti-OLR1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human OLR1 |
Chicken Polyclonal ApoA1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1. |
MMP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP1 |
Rabbit anti-PLTP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PLTP |
Rabbit Polyclonal Adiponectin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Adiponectin antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human adiponectin. The immunogen is located within the last 50 amino acids of Adiponectin. |
Rabbit polyclonal anti-APOA5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOA5. |
Rabbit polyclonal MMP1 (Cleaved-Phe100) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Rabbit polyclonal anti-LOX-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide near the N-terminus of human Lox-1 |
Rabbit polyclonal MMP1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Mouse Monoclonal anti-MMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Adiponectin (ADIPOQ) mouse monoclonal antibody, clone Adn63
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 530.00
2 Weeks
LOX 1 (OLR1) (sLOX-1) mouse monoclonal antibody, clone LOX19-22
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal MMP1 (Cleaved-Pro269) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Rabbit polyclonal anti-Angptl4 (FIAF) antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 84 of mouse FIAF |
Rabbit Polyclonal ApoA1 Antibody
| Applications | WB |
| Reactivities | Chicken, Human |
| Conjugation | Unconjugated |
| Immunogen | ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1. |
Rabbit Polyclonal Anti-APOA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
Goat Polyclonal Antibody against APOA5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HSLHDQGHSHLGDP, from the C Terminus of the protein sequence according to NP_443200.2. |
Rabbit polyclonal anti-APOA2 antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2. |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) APOA5 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) APOA5 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) APOA5 mouse monoclonal antibody, clone OTI3A5 (formerly 3A5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI7G1 (formerly 7G1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Applications
- WB
Conjugates
- Unconjugated
Families
- Secreted Protein
Pathways
- PPAR signaling pathway