Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Mouse Monoclonal beta Actin Antibody
Applications | WB |
Reactivities | Human, Broad |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACTB |
Rabbit anti-PRKCA Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human PRKCA |
Goat Polyclonal Anti-beta-Actin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. |
Rabbit Polyclonal Beta-actin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | b-actin antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human b-actin. |
Chicken Polyclonal Anti-Beta-actin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the amino terminus of human beta-actin. |
Rabbit Polyclonal antibody to beta Actin (actin, beta)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
Mouse Monoclonal beta-Actin Antibody (8H10D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat, Primate, Hamster |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACTB |
Chicken Polyclonal Anti-Beta-actin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human beta-actin. |
Mouse Monoclonal beta Actin Antibody
Applications | WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Actin-pan Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Beta actin antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin |
Rabbit polyclonal PKC a (Ab-657) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
Rabbit polyclonal anti-Actin-pan antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Actin. |
Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638 |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497 |
Modifications | Phospho-specific |
Rabbit Polyclonal PKC alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha |
Rabbit Polyclonal PKC-pan Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan |
Rabbit Polyclonal beta-Actin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Rabbit Polyclonal antibody to PKC alpha (protein kinase C, alpha)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 250 of PKC alpha (Uniprot ID#P17252) |
Rabbit polyclonal PKC a (Tyr657) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
Modifications | Phospho-specific |
Rabbit Polyclonal beta-Actin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Amino acids 2-16 (CDDDIAALVIDNGSG) of actin protein were used as the immunogen. |
Rabbit Polyclonal beta-Actin Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A region corresponding to the N-terminus of human Beta Actin [UniProt# P60709] |
Rabbit Polyclonal Anti-beta-Actin Antibody (biotin)
Applications | WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Biotin-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Rabbit Polyclonal Anti-beta-Actin Antibody (HRP)
Applications | WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | HRP-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7]
Applications | WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)
Applications | WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRKCA mouse monoclonal antibody, clone OTI3D2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRKCA mouse monoclonal antibody, clone OTI5F4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-PRKCA rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Anti-PRKCA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Rabbit Polyclonal Anti-PRKCA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PRKCA |
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control, Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control, HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PRKCA mouse monoclonal antibody, clone OTI3D2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
PRKCA mouse monoclonal antibody, clone OTI3D2, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
PRKCA mouse monoclonal antibody, clone OTI3D2, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PRKCA mouse monoclonal antibody, clone OTI3D2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PRKCA mouse monoclonal antibody, clone OTI5F4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
PRKCA mouse monoclonal antibody, clone OTI5F4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
2 Weeks
PRKCA mouse monoclonal antibody, clone OTI5F4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PRKCA mouse monoclonal antibody, clone OTI5F4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB |
Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB |