Antibodies

View as table Download

Rabbit Polyclonal Anti-FUSIP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS

Rabbit Polyclonal Anti-CDC5L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC5L antibody: synthetic peptide directed towards the middle region of human CDC5L. Synthetic peptide located within the following region: LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE

Rabbit Polyclonal Anti-PPIE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Rabbit anti-CDC5L Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC5L

Rabbit Polyclonal Anti-TCERG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCERG1 antibody: synthetic peptide directed towards the N terminal of human TCERG1. Synthetic peptide located within the following region: AERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPP

Rabbit Polyclonal Anti-FUSIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: KSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEK

Rabbit Polyclonal Anti-PPIE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG

Rabbit Polyclonal Anti-FUSIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the N terminal of human FUSIP1. Synthetic peptide located within the following region: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP

Rabbit Polyclonal SkiP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SkiP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human SkiP .

Rabbit polyclonal anti-BUD31 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BUD31.

Rabbit Polyclonal anti-PQBP1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: PSCGLPYYWNADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPS

Rabbit Polyclonal Anti-SKIIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE

Goat Polyclonal Antibody against XAB2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SVPAAVFGSLKED, from the C Terminus of the protein sequence according to NP_064581.2.

Rabbit Polyclonal Anti-PQBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: LVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSH

Rabbit Polyclonal Anti-TCERG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCERG1 antibody: synthetic peptide directed towards the middle region of human TCERG1. Synthetic peptide located within the following region: LLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIK

Rabbit Polyclonal Anti-PLRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLRG1 Antibody: synthetic peptide directed towards the N terminal of human PLRG1. Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP

Rabbit Polyclonal Anti-XAB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the N terminal of human XAB2. Synthetic peptide located within the following region: VKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKH

Rabbit Polyclonal Anti-XAB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XAB2 antibody: synthetic peptide directed towards the C terminal of human XAB2. Synthetic peptide located within the following region: KILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQS

Rabbit Polyclonal Anti-PHF5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHF5A antibody: synthetic peptide directed towards the middle region of human PHF5A. Synthetic peptide located within the following region: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK

Rabbit Polyclonal Anti-BUD31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the N terminal of human BUD31. Synthetic peptide located within the following region: PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR

Rabbit Polyclonal Anti-BUD31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BUD31 antibody: synthetic peptide directed towards the middle region of human BUD31. Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR