Germany
Japan
United Kingdom
China
Antibodies
View as table Download
DBH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBH |
Rabbit anti-AOC3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AOC3 |
Goat Polyclonal Antibody against MAOB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Rabbit Polyclonal Anti-Tyrp1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN |
Rabbit Polyclonal Anti-COMT Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH |
Anti-TYR Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase |
Anti-DCT Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 222-472 amino acids of human dopachrome tautomerase |
Active filters
Reactivities
- Rat
Applications
- WB
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Tyrosine metabolism