Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
View as table Download
Goat Anti-NOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1. |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit polyclonal anti-NOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit anti-CLCN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN1 |
Rabbit Polyclonal Anti-VDAC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
Goat Polyclonal Anti-ASIC1 Antibody
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASIC1 Antibody: Peptide with sequence C-NILPHHPARGT, from the C Terminus of the protein sequence according to NP_064423.2; NP_001086.2; NP_001243759.1. |
Mouse Monoclonal anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-CLCN7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLCN7. |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CLC4 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CLC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 663-689 amino acids from the C-terminal region of human CLC4. |
Goat Anti-CLIC1 / NCC27 (aa45-57) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TVDTKRRTETVQK, from the internal region of the protein sequence according to NP_001279.2. |
Rabbit anti-CLCN5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN5 |
Rabbit anti-BEST1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BEST1 |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Rabbit Polyclonal Anti-Connexin 26 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |
Rabbit Polyclonal Anti-Connexin 32 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |
Rabbit Polyclonal Anti-AQP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AQP1 Antibody: A synthesized peptide derived from human AQP1 |
Rabbit Polyclonal Anti-Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Anti-Trophinin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Trophinin antibody was raised against a 16 amino acid peptide near the amino terminus of human Trophinin. |
Rabbit Polyclonal Anti-TNFAIP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TNFAIP1 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TNFAIP1. |
Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-AQP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AQP1. |
Rabbit polyclonal anti-CLCN4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLCN4. |
Rabbit polyclonal anti-TNAP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNAP1. |
Rabbit polyclonal anti-KCNMB2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KCNMB2. |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Connexin 43 |
Goat Anti-CLCN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QQLDEPVNFSDCK, from the internal region of the protein sequence according to NP_004357.3. |
Rabbit polyclonal anti-CACNG1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Active filters
Reactivities
- Mouse
Applications
- WB
Families
- Ion Channels: Other
Filter by
Category
Target Symbol
- KCNAB1 (52)
- KCNIP2 (37)
- BEST3 (25)
- KCTD13 (20)
- AQP1 (19)
- NUDT9 (15)
- TOMM40L (15)
- GJA1 (11)
- TOMM40 (7)
- CACNB1 (6)
- CLIC1 (5)
- KCTD5 (5)
- CLIC4 (4)
- TNFAIP1 (4)
- CACNB4 (3)
- CLCN5 (3)
- GJB1 (3)
- KCNAB2 (3)
- KCNMB2 (3)
- NOX1 (3)
- VDAC1 (3)
- VDAC2 (3)
- ABCC4 (2)
- ASIC1 (2)
- BEST1 (2)
- CACNB2 (2)
- CACNG1 (2)
- CLCN1 (2)
- CLCN4 (2)
- CYBB (2)
- GJD2 (2)
- CACNA2D2 (1)
- CACNA2D3 (1)
- CACNA2D4 (1)
- CACNG3 (1)
- CACNG6 (1)
- CACNG7 (1)
- CATSPER3 (1)
- CHRFAM7A (1)
- CLCA4 (1)
- CLCN2 (1)
- CLCN6 (1)
- CLCN7 (1)
- CLIC3 (1)
- FXYD1 (1)
- FXYD7 (1)
- GJA4 (1)
- GJB2 (1)
- GJB4 (1)
- GJC1 (1)
- GJC2 (1)
- KCNE1 (1)
- KCNE3 (1)
- KCNG3 (1)
- KCNH6 (1)
- KCNMB1 (1)
- KCNMB3 (1)
- KCNMB4 (1)
- KCTD11 (1)
- KCTD12 (1)
- KCTD15 (1)
- SCNN1B (1)
- SHKBP1 (1)
- VDAC3 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (30)
- Amyotrophic lateral sclerosis (ALS) (22)
- Cardiac muscle contraction (19)
- Dilated cardiomyopathy (19)
- Hypertrophic cardiomyopathy (HCM) (19)
- MAPK signaling pathway (19)
- Purine metabolism (15)
- Gap junction (13)
- Calcium signaling pathway (7)
- Huntington's disease (7)
- Parkinson's disease (7)
- Vascular smooth muscle contraction (6)
- Leukocyte transendothelial migration (5)
- ABC transporters (2)
- Olfactory transduction (1)
- Taste transduction (1)