Antibodies

View as table Download

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

IKBKE Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IKBKE

Rabbit anti-CHUK Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CHUK

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

Rabbit polyclonal p38 MAPK (Ab-322) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q).

Rabbit polyclonal p38 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig
Conjugation Unconjugated
Immunogen A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH.

Mouse Monoclonal NAK Antibody (108A429)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
TA336453 is a replacement of AM08296PU-N.

Rabbit Polyclonal RIPK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1.

Rabbit Polyclonal MAP3K7 (Thr187) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MAP3K7 around the phosphorylation site of Threonine 187
Modifications Phospho-specific

IKBKB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IKBKB

TBK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TBK1

Rabbit anti-MAPK14 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human MAPK14

Rabbit Polyclonal Anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody: A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Thr180/Tyr182) .
Modifications Phospho-specific

Rabbit polyclonal IKK-alpha (Ser176)/IKK-beta (Phospho-Ser177) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-a around the phosphorylation site of serine 176/177 (Q-G-SP-L-C).
Modifications Phospho-specific

Rabbit polyclonal MAP3K7 (Ab-187) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized non-phosphopeptide derived from human MAP3K7 around the phosphorylation site of threonine 187 (H-M-TP-N-N).

Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A).
Modifications Phospho-specific

Anti-MAPK10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10

Rabbit Polyclonal p38 MAPK (Tyr322) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 322
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Ab-179/181) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human p38 MAPK.

Rabbit anti-JNK2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen C term -peptide of human JNK2

MAPK10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAPK10

Rabbit anti-Phospho-MAPK8/9/10-T183/Y185 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T183/Y185 of human MAPK8/MAPK9/MAPK10

Mouse Monoclonal IKK beta Antibody (10AG2)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse Monoclonal IKK alpha Antibody (14A231)

Applications FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Rabbit polyclonal anti-MAPK10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAPK10.

Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V).
Modifications Phospho-specific

Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14.

Rabbit Polyclonal IKK-alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-alpha

Rabbit Polyclonal IKK-alpha/beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-alpha/beta

Rabbit Polyclonal IKK-alpha/beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-alpha/beta

Rabbit Polyclonal IKK- alpha (Ser176) /IKK- beta (Ser177) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- alpha /IKK- beta around the phosphorylation site of Serine 177
Modifications Phospho-specific

Rabbit Polyclonal IKK- alpha (Thr23) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- alpha around the phosphorylation site of Threonine 23
Modifications Phospho-specific

Rabbit Polyclonal IKK- alpha/ beta (Ser180/181) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- alpha/ beta around the phosphorylation site of Serine 180/181
Modifications Phospho-specific

Rabbit Polyclonal IKK-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-beta

Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188
Modifications Phospho-specific

Rabbit Polyclonal IKK- beta (Tyr199) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 199
Modifications Phospho-specific

Rabbit Polyclonal p38 MAPK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK

Rabbit Polyclonal p38 MAPK (Thr180) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Threonine 180
Modifications Phospho-specific

Rabbit Polyclonal p38 MAPK (Tyr182) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 182
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Phospho-Thr180) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human P38 MAPK around the phosphorylation site of threonine 179 (E-M-TP-G-Y).
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Phospho-Thr179+Tyr181) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p38 MAPK around the phosphorylation site of threonine 179 and tyrosine 181 (E-M-TP-G-YP-V-A).
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Ab-182) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human P38MAPK around the phosphorylation site of tyrosine 182 (T-G-YP-V-A).

Rabbit polyclonal MAP2K7 (Ab-271) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A).

Rabbit polyclonal TAK1 (Ab-184) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TAK1 around the phosphorylation site of threonine 184 (I-Q-TP-H-M).

Rabbit Polyclonal Antibody against MAPK14 (Y322)

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 301-330 amino acids from human MAPK14.

Goat Polyclonal Antibody against MAP3K7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AELDQDEKDQQNT, from the internal region of the protein sequence according to NP_003179.1; NP_663304.1.

Rabbit Polyclonal TAK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TAK1 antibody was raised against a synthetic peptide corresponding to 14 amino acids near the amino-terminus of human TAK1 isoform a.