TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit anti-TNF-R1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNF-R1 |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Rat |
TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A |
Rabbit anti-TNFRSF1B Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFRSF1B |
Rabbit Polyclonal Anti-TNF-R2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNF-R2 Antibody: A synthesized peptide derived from human TNF-R2 |
Rabbit Polyclonal Anti-TNF-R2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNF-R2 Antibody: A synthesized peptide derived from human TNF-R2 |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Goat, Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211). |
TNFRSF1A (20-43) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
Immunogen | TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1. |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNFRSF1B (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human TNFR2/TNFRSF1B. |
TNFRSF1A rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 259-288 amino acids from human TNFR |
Rabbit polyclonal TNF Receptor II antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TNF Receptor II. |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Goat Anti-TNFRSF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1. |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFA mouse monoclonal antibody,clone OTI5A11
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TNFRSF1B Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 291-461 amino acids of human tumor necrosis factor receptor superfamily, member 1B |
Anti-TNFRSF1B Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 291-461 amino acids of human tumor necrosis factor receptor superfamily, member 1B |
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNFA mouse monoclonal antibody,clone OTI5A11
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFA mouse monoclonal antibody,clone OTI5A11, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNFA mouse monoclonal antibody,clone OTI5A11, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
TNFA mouse monoclonal antibody,clone OTI5A11
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI4B9 (formerly 4B9), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNF mouse monoclonal antibody, clone OTI4B9 (formerly 4B9), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
TNF mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |