Rabbit polyclonal IGF1R (Ab-1346) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal TGF Beta Receptor I (Ab-165) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGF β Receptor I around the phosphorylation site of serine 165 (D-P-SP-L-D). |
Rabbit polyclonal CSFR (Tyr561) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 561 (N-S-YP-T-F). |
| Modifications | Phospho-specific |
Rabbit polyclonal HER2 (Tyr877) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HER2 around the phosphorylation site of Tyrosine 877 (T-E-YP-H-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal FGFR1 (Ab-766) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human FGFR1 around the phosphorylation site of tyrosine 766 (Q-E-YP-L-D). |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TGF beta3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit polyclonal anti-FZD10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit polyclonal anti-ACVR1C (ALK7) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 155 of mouse ALK-7 |
Rabbit polyclonal ERBB2 Antibody(N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERBB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 21-52 amino acids from the N-terminal region of human ERBB2. |
Rabbit polyclonal PDGFRB Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PDGFRB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-72 amino acids from the N-terminal region of human PDGFRB. |
Rabbit Polyclonal Ret Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Ret |
Rabbit polyclonal Trk A (Phospho-Tyr701) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 701 (I-L-YP-R-K). |
| Modifications | Phospho-specific |
FGF10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGF10 |
Rabbit Polyclonal Phospho-HER2 (Tyr1248) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HER2 around the phosphorylation site of Tyrosine 1248 |
| Modifications | Phospho-specific |
Rabbit Polyclonal HER2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HER2 |
Rabbit anti-ACVR1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACVR1B |
Rabbit anti-ITGA2B Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGA2B |
Rabbit Polyclonal Anti-FZD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI |
Rabbit Polyclonal Anti-WNT9B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B. Synthetic peptide located within the following region: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5. Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH |
Rabbit Polyclonal Anti-FZD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS |
Rabbit Polyclonal Anti-FZD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Rabbit Polyclonal Anti-FZD8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD8 antibody: synthetic peptide directed towards the N terminal of human FZD8. Synthetic peptide located within the following region: PDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHR |
Rabbit Polyclonal Anti-M-CSF Receptor Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-M-CSF Receptor Antibody: A synthesized peptide derived from human M-CSF Receptor |
Rabbit Polyclonal Anti-Bax Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Rabbit Polyclonal Anti-E-cadherin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E-cadherin Antibody: A synthesized peptide derived from human E-cadherin |
Rabbit Polyclonal Anti-FGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGFR2 Antibody: A synthesized peptide derived from human FGFR2 |
Rabbit Polyclonal Anti-Patched Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched |
Rabbit Polyclonal Anti-PDGFRalpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFRalpha Antibody: A synthesized peptide derived from human PDGFRalpha |
Rabbit Polyclonal Anti-TGF alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF alpha Antibody: A synthesized peptide derived from human TGF alpha |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-BCL-2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL-2 Antibody: A synthesized peptide derived from human BCL-2 |
Germany
Japan
United Kingdom
China
