Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-NDUFA4L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit Polyclonal TCIRG1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-COX IV antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
COX7A1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 9-38 amino acids from the Central region of human COX7A1 |
Rabbit anti-ATP6AP1 Polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ATP6AP1 |
Rabbit polyclonal anti-COX6C antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX6C. |
Rabbit polyclonal anti-NDUFA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4. |
Rabbit polyclonal anti-COX42 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX42. |
Rabbit polyclonal COX41 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human COX41. |
Rabbit Polyclonal Anti-ATP5G2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP5G2 antibody: synthetic peptide directed towards the N terminal of human ATP5G2. Synthetic peptide located within the following region: SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA |
Rabbit Polyclonal Anti-COX11 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX11 Antibody: A synthesized peptide derived from human COX11 |
Rabbit Polyclonal Anti-COX42 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42 |
Rabbit Polyclonal Anti-COX6C Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |
Rabbit Polyclonal Anti-COX IV antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV |
COX4 (COX4I1) (154-166) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey |
Immunogen | Synthetic peptide from C-term of human COX4I1 |
COX10 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 386-414 amino acids from the C-terminal region of human COX1 |
COX6A1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 50 - 78 amino acids from the Center region of human COX6A1 |
NDUFA11 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 71-100 amino acids from the Central region of human NDUFA11 |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit polyclonal antibody to V-ATPase 116 kDa isoform a4 (ATPase, H+ transporting, lysosomal V0 subunit a4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 53 and 295 of V-ATPase 116 kDa isoform a4 (Uniprot ID#Q9HBG4) |
Rabbit Polyclonal antibody to COX4 (cytochrome c oxidase subunit IV isoform 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 169 of COX4 (Uniprot ID#P13073) |
Rabbit polyclonal anti-MT-ND1 antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MT-ND1. |
Rabbit polyclonal anti-MT-ND5 antibody
Applications | WB |
Reactivities | Human (Identities = 100%, Positives = 100%) |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MT-ND5. |
Rabbit Polyclonal Anti-ND6 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-ND6 antibody: synthetic peptide directed towards the middle region of human ND6. Synthetic peptide located within the following region: DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT |
Rabbit Polyclonal Anti-Atp6v0a1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
NDUFA4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 51-100 of Human NDUFA4. |
ATP5MC1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 27-56 amino acids from the Central region of Human ATP5G1. |
ATP6V0B (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 111-139 amino acids from the Central region of human ATP6V0B |
COX4 (COX4I1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 32~62 amino acids from the N-terminal region of human COX4I1 |
COX7A2L (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 36-65 amino acids from the Central region of human COX7A2L |
NDUFC2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 93-123 amino acids from the C-terminal region of human NDUFC2 |
Rabbit Polyclonal Anti-ATP6V0A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP6V0A1 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A1. Synthetic peptide located within the following region: RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE |
Rabbit Polyclonal Anti-COX15 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
COX4 (COX4I1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide surrounding amino acid 32 of human Cox IV. |
ATP12A (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ATP12A |
ATP6AP1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Canine, Equine, Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide directed towards the middle region of human ATP6AP1 |
ATP6V0C (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 107-134 amino acids from the C-terminal region of human ATP6V0C |
Goat Polyclonal Antibody against COX4I1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGLASKWDYEKNE, from the C Terminus of the protein sequence according to NP_001852.1. |
Rabbit polyclonal antibody to ATP synthase C1(mitochondrial) (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 82 of ATP5G1 (Uniprot ID#P05496) |
Rabbit Polyclonal antibody to ATP6V0A2 (ATPase, H+ transporting, lysosomal V0 subunit a2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 156 and 434 of ATP6V0A2 (Uniprot ID#Q9Y487) |
Goat Anti-COX4I2 & COX4I1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RWDYEKKQWKK, from the C Terminus of the protein sequence according to NP_115998.2. |
Rabbit Polyclonal TCIRG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCIRG1 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCIRG1. |
Anti-ATP6AP1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-390 amino acids of human ATPase, H+ transporting, lysosomal accessory protein 1 |
Mouse Monoclonal anti-Cytochrome c Antibody
Applications | WB |
Reactivities | Most Species |
Conjugation | Unconjugated |
Rabbit polyclonal anti-NDUA4 antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NDUA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 56-80 amino acids from the C-terminal region of human NDUA4. |
MT-ATP6 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Test: Human. Expected from seq similarity: Human |
Immunogen | Internal region (PTSKYLINNRLITTQ) |
Rabbit Polyclonal Anti-COX7A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the middle region of Human COX7A2. Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY |