Antibodies

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Lyve1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Mouse, Rat
Immunogen Highly pure (> 95%) recombinant Mouse soluble LYVE-1 (Ala24-Gly228) produced in insect cells (Cat.-No DA3524).

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to CACNA1B (calcium channel, voltage-dependent, N type, alpha 1B subunit)

Applications IF, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 2013 and 2209 of CACNA1B (Uniprot ID#Q00975)

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Rabbit Polyclonal RNAse H2A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RNAse H2A antibody was raised against a 17 amino acid peptide near the center of human RNAse H2A.

Rabbit polyclonal anti-ABCC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC3.

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against LC3B

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein.

USD 320.00

In Stock

Goat Polyclonal Anti-CANX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli.

Vsx2 (N-term) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Mouse, Rat
Immunogen A recombinant protein corresponding to amino acids 1 to 131 derived from the N-terminal of the Human Chx10 protein conjugated to GST.

Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat, Sheep
Immunogen Collagen type II purified from Human knee and Bovine nasal cartilage.

Pdpn hamster monoclonal antibody, clone 811, Purified

Applications IHC, IP, WB
Reactivities Mouse

USD 320.00

In Stock

Goat Polyclonal Anti-CD63 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.

Rabbit Polyclonal Anti-GPA33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GPA33

Rabbit polyclonal anti-ABCC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC2.

Rabbit Polyclonal Anti-NOX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOX4 antibody was raised against a 14 amino acid peptide near the amino terminus of human NOX4.

Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591)

Goat Anti-GATA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1.

Epstein Barr Virus / EBV EBNA 3B sheep polyclonal antibody, Purified

Applications WB
Immunogen Recombinant EBNA-3B protein.

Rabbit Polyclonal PD-L1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1.

Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L).
Modifications Phospho-specific

PGK1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bakers Yeast
Immunogen 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Epstein Barr Virus / EBV EBNA 3A sheep polyclonal antibody, Purified

Applications WB
Immunogen Recombinant EBNA-3A protein.

Rabbit Polyclonal VLK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK.

USD 320.00

In Stock

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

USD 320.00

In Stock

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

EDG1 (S1PR1) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the C-terminal of the EDG-1 receptor

Rabbit anti-Nono Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A specific peptide of human Nono

Rabbit Polyclonal Dact2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Dact2 antibody was raised against a 12 amino acid peptide from near the amino terminus of human DACT2.

Rabbit polyclonal SLC11A2 Antibody (Center)

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2.

DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

Rabbit Polyclonal Anti-LILRB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human LILRB2

USD 450.00

In Stock

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities A. victoria
Immunogen Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria

Rabbit anti-BRCA1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).

Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit anti-REG3A Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human REG3A

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit Polyclonal OCLN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN.

Rabbit anti-IRF3 Polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IRF3

USD 320.00

In Stock

Goat Polyclonal Anti-CANX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli.

Rabbit anti-ZEB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ZEB1