Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal PLCG1 (Ab-771) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal anti-PIK3C2G antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human P3C2G. |
INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%). |
USD 345.00
In Stock
Rabbit polyclonal anti-DGKA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKA. |
Rabbit polyclonal PKC a (Ab-657) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
Rabbit polyclonal anti-PIK3R5 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIK3R5. |
Rabbit polyclonal anti-DGKB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKB. |
Rabbit polyclonal anti-PRKCG antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKCG. |
Rabbit polyclonal anti-DGKQ antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKQ. |
Rabbit polyclonal anti-DGKE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
Rabbit Polyclonal Calmodulin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Calmodulin |
Rabbit polyclonal PRKCG (Ab-655) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr771) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr783) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 783 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Calmodulin (Thr79+Ser81) Antibody (Phospho-specific)
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Calmodulin around the phosphorylation site of Threonine 79+Serine 81 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB |
Rabbit Polyclonal PLCG2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG2 |
Rabbit Polyclonal PKC alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha |
Rabbit Polyclonal PKC-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal PTEN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal Phospho-PLCG2 (Tyr753) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PLCG2 around the phosphorylation site of Tyrosine 753. |
| Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) PIK3CG mouse monoclonal antibody, clone OTI4H9 (formerly 4H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Active filters
Pathways
- Phosphatidylinositol signaling system
Availabilities
- In Stock
Filter by
Category
Target Symbol
- PIK3C2A (44)
- PIK3CG (26)
- PIK3R5 (19)
- DGKA (15)
- PIK3CD (15)
- PRKCA (10)
- PIKFYVE (9)
- PIK3CA (8)
- PTEN (6)
- PLCG1 (5)
- PIP4K2A (4)
- DGKB (3)
- DGKZ (3)
- PIK3C2B (3)
- PRKCB (3)
- PRKCG (3)
- CALM3 (2)
- ITPK1 (2)
- PIK3R3 (2)
- PLCG2 (2)
- CALM1 (1)
- CALM2 (1)
- DGKE (1)
- DGKH (1)
- DGKI (1)
- DGKQ (1)
- INPP4A (1)
- INPP5K (1)
- INPPL1 (1)
- IPPK (1)
- ITPR1 (1)
- ITPR2 (1)
- ITPR3 (1)
- PIB5PA (1)
- PIK3C2G (1)
- PIK3C3 (1)
- PIK3CB (1)
- PIK3R1 (1)
- PIK3R2 (1)
- PIP5K1A (1)
- PIP5K1B (1)
- PIP5K1C (1)
- PLCB3 (1)
- PLCZ1 (1)