Goat Anti-CACNA1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Goat Anti-CACNA1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit Polyclonal Anti-TPM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
TPM1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TPM1 |
Goat Polyclonal Anti-cardiac troponin T Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Feline, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-cardiac troponin T Antibody: Peptide with sequence C-RNRINDNQKVSKT, from the C Terminus of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
USD 415.00
In Stock
Rabbit Polyclonal antibody to UQCRC1 (ubiquinol-cytochrome c reductase core protein I)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of UQCRC1 (Uniprot ID#P31930) |
Rabbit Polyclonal Anti-TPM1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
Rabbit polyclonal CACNA2D2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal anti-ATP1A1(NaK ATPase) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATP1A1 |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Rabbit Polyclonal Anti-MYL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG |
Rabbit Polyclonal Anti-LCMT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
Goat Polyclonal Anti-VASP (aa236-249) Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-VASP (aa236-249) Antibody: Peptide with sequence C-RKVSKQEEASGGPT, from the internal region of the protein sequence according to NP_003361.1. |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CACNB1 |
Rabbit Polyclonal CACNB2 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Nhe-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nhe-1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of the human Nhe-1. The immunogen is located within the last 50 amino acids of Nhe-1. |
Rabbit Polyclonal Nhe-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nhe-1 antibody was raised against a 17 amino acid synthetic peptide near the center of the human Nhe-1. The immunogen is located within amino acids 490 - 540 of Nhe-1. |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal anti-CYC1 antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYC1. |
Rabbit polyclonal anti-SLC9A6 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC9A6. |
Rabbit polyclonal anti-RyR2 (Ser2808) antibody (Phospho-specific)
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific phosphopeptide. The antibody against non-phosphopeptide was removed by chromatography using non-phosphopeptide corresponding to the phosphorylation site. |
Modifications | Phospho-specific |
Rabbit Polyclonal TYW4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4. |
Rabbit polyclonal CACNG6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal ATPase Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ATPase |
Rabbit Polyclonal ATPase (Ser16) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ATPase around the phosphorylation site of Serine 16 |
Modifications | Phospho-specific |
Rabbit Polyclonal TNNI3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 |
Rabbit Polyclonal TNNI3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 |
Rabbit Polyclonal TNNI3 (Ser43) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 around the phosphorylation site of Serine 43 |
Modifications | Phospho-specific |
Rabbit Polyclonal TNNI3 (Thr142) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNNI3 around the phosphorylation site of Threonine 142 |
Modifications | Phospho-specific |
Rabbit polyclonal antibody to CACNG5 (calcium channel, voltage-dependent, gamma subunit 5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 43 and 246 of CACNG5 (Uniprot ID#Q9UF02) |
Rabbit polyclonal anti-CACNG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG1. |
Rabbit polyclonal anti-CACNA2D4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNA2D4. |
Rabbit polyclonal CACNA2D3 Antibody (C-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CACNA2D3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1026-1053 amino acids from the C-terminal region of human CACNA2D3. |
Rabbit Polyclonal Anti-Cacng1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL |
Rabbit Polyclonal Anti-CACNA2D1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI |
Rabbit Polyclonal Anti-CACNG6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA |
Rabbit Polyclonal Anti-CACNB1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
USD 435.00
2 Weeks
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone p45-10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against CACNB4 (C terminus)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CSPGGYSHDSRHRL, from the C Terminus of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1. |
Goat Polyclonal Antibody against CACNB4 (internal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DYPDSYQDTYKPH, from the internal region (near the C Terminus) of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1. |
Goat Polyclonal Antibody against CACNA2D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QEIFNKYNKDKKVR, from the internal region of the protein sequence according to NP_000713.2. |
Rabbit polyclonal anti-MYL3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MYL3. |
Rabbit polyclonal anti-CACNG7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Anti-ATP2A2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 111-253 amino acids of human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 |
Rabbit Polyclonal Anti-CACNB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CACNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNB3. Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS |
Rabbit polyclonal Anti-CACNG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNG1 antibody: synthetic peptide directed towards the N terminal of human CACNG1. Synthetic peptide located within the following region: SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSL |
Rabbit polyclonal Anti-CACNG4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-SLC9A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC9A1 Antibody: synthetic peptide directed towards the middle region of human SLC9A1. Synthetic peptide located within the following region: RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG |
Rabbit Polyclonal Anti-CACNA2D4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNA2D4 antibody is: synthetic peptide directed towards the middle region of Human CACNA2D4. Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV |
Rabbit Polyclonal Anti-CACNA2D2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNA2D2 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNA2D2. Synthetic peptide located within the following region: NCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELV |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |