Antibodies

View as table Download

Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-AHCY Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AHCY

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Rabbit Polyclonal DNMT3B Antibody

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein.

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE

Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTAP Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MTAP

Goat Polyclonal Antibody against MTR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.

Rabbit anti-CBS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBS

Rabbit Polyclonal Anti-MAT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Rabbit Polyclonal DNMT1 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT1 antibody: mouse DNMT1 (DNA (cytosine-5)-methyltransferase 1), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the C-terminal part of the protein.

Rabbit Polyclonal DNMT3A Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 44-58.

Rabbit Polyclonal DNMT3A Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 92-106.

Rabbit Polyclonal DNMT3A Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 107-121.

Rabbit Polyclonal DNMT3B Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein

Rabbit Polyclonal DNMT2 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT2 antibody: mouse Dnmt2 (DNA methyltransferase 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein (1).

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

DNMT3A Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DNMT3A

DNMT3B Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human DNMT3B

Rabbit polyclonal Anti-DNMT3B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC

Rabbit Polyclonal Anti-MAT1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the C terminal of human MAT1A. Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH

Rabbit Polyclonal Anti-MPST Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MPST antibody: synthetic peptide directed towards the middle region of human MPST. Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT

Anti-AMD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

Rabbit anti-LDHA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LDHA

Rabbit Polyclonal Anti-MTR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTR antibody: synthetic peptide directed towards the C terminal of human MTR. Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRDMT1 antibody: synthetic peptide directed towards the N terminal of human TRDMT1. Synthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV

Rabbit Polyclonal Antibody against DNMT3a

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was raised against amino acids 10-118 of the human DNMT3a protein.

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

Rabbit polyclonal anti-IL4I1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1.

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Internal region (near C terminus) (NARGLTSVINQKLK)

Rabbit Polyclonal TAT Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal antibody to MTAP (methylthioadenosine phosphorylase)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 283 of MTAP (Uniprot ID#Q13126)

Rabbit Polyclonal Anti-AHCYL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AHCYL2. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE

Rabbit Polyclonal Anti-AHCY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AHCY antibody: synthetic peptide directed towards the N terminal of human AHCY.

Goat Polyclonal Antibody against DNMT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFESPPKTQPTEDN, from the internal egion of the protein sequence according to NP_001370.1.

Rabbit polyclonal anti-DNMT3L antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 152-164 of Human DNMT3L (DNA (cytosine-5-)-methyltransferase 3-like). DNMT3L is a nuclear protein with similarity to DNA methyltransferases.

Anti-LDHB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human LDHB

LDHA Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen C Terminus (SDLVKVTLTSE)

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (near N terminus) (EEATVPNNKIT)

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE

Rabbit Polyclonal Anti-AMD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMD1 antibody: synthetic peptide directed towards the N terminal of human AMD1. Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Rabbit Polyclonal Anti-IL4I1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS

Anti-MAT1A Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha

Anti-MAT1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha