Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Goat Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit anti-RFC4 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC4 |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit polyclonal anti-PCNA antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PCNA |
Rabbit Polyclonal PCNA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
MNAT1 Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MNAT1 |
Rabbit Polyclonal RFC4 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-PCNA antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PCNA. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal Anti-POLD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Mouse Monoclonal RPA70 Antibody
Applications | IF, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA |
Rabbit Polyclonal Anti-CDK7 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK7 Antibody: A synthesized peptide derived from human CDK7 |
Rabbit Polyclonal Anti-TF2H2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TF2H2 Antibody: A synthesized peptide derived from human TF2H2 |
Goat Polyclonal Anti-CDK7 (aa47-58) Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CDK7 (aa47-58) Antibody: Peptide with sequence C-HRSEAKDGINRT, from the internal region of the protein sequence according to NP_001790.1. |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244) |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Rabbit polyclonal anti-ERCC5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ERCC5. |
Rabbit polyclonal RFA2 (Ab-21) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Rabbit polyclonal anti-RFC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RFC2. |
Rabbit polyclonal anti-TF2H2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit polyclonal anti-MAT1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAT1. |
Rabbit polyclonal Phospho-CDK7(T170) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
Modifications | Phospho-specific |
Rabbit Polyclonal RFA2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 |
Rabbit Polyclonal RFA2 (Thr21) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 around the phosphorylation site of Threonine 21 |
Modifications | Phospho-specific |
Mouse Monoclonal RPA32/RPA2 Antibody
Applications | IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RFC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RFC2 |
Rabbit Polyclonal XPG Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340) |
Mouse Monoclonal PCNA Antibody (PC10)
Applications | IHC, WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
Rabbit polyclonal anti-POLD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CDK7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CDK7. |
Anti-RPA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human replication protein A1, 70kDa |
Rabbit Polyclonal Anti-GTF2H2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the C terminal of human GTF2H2. Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC |
Rabbit Polyclonal Anti-CDK7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-CDK7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-RFC5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE |
Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-PCNA antibody
Applications | WB |
Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Rabbit polyclonal anti-PCNA antibody
Applications | WB |
Reactivities | Algal |
Conjugation | Unconjugated |
Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 55-71 of Isochrysis galbana PCNA. |
Goat Polyclonal RPA1/RPA70 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CKSYEDATKITVRSN (aa323-337), from the internal region of the protein sequence according to NP_002936.1 |
Mouse Anti-Human PCNA Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-MNAT1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal POLD2 Antibody (Center)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Mouse monoclonal anti-PCNA antibody (C-term)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |