Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Chicken Polyclonal Anti-Beta-actin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human beta-actin. |
Mouse Monoclonal beta Actin Antibody
| Applications | WB |
| Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Beta actin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin |
Rabbit polyclonal CASP3 (p17, Cleaved-Asp175) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Anti-CASP3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 485-499 of Human caspase 3, apoptosis-related cysteine peptidase |
Rabbit polyclonal CASP3 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 219-248 amino acids from the C-terminal region of human CASP3. |
Rabbit Polyclonal Caspase 3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 3 |
Rabbit Polyclonal Caspase 3 (Ser150) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 3 around the phosphorylation site of Serine 150 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Cleaved-caspase 3 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Goat Anti-Caspase 3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDVSKEDHSKRS, from the internal region of the protein sequence according to NP_004337.2; NP_116786.1. |
Rabbit anti-ICAM1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ICAM1 |
Rabbit Polyclonal Anti-beta-Actin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Rabbit Polyclonal Anti-beta-Actin Antibody (HRP)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRP-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin. |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7]
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-beta-Actin Antibody [10B7] (biotin)
| Applications | WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CASP3 mouse monoclonal antibody,clone OTI1D2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-ITGAL Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1158-1170 amino acids of Human integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) |
Anti-CASP3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Families
- ES Cell Differentiation/IPS
Pathways
- Viral myocarditis