Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 379.00
In Stock
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN |
USD 379.00
In Stock
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
USD 415.00
In Stock
GGT1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GGT1 |
Rabbit Polyclonal Anti-PIGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD |
Rabbit anti-LTA4H Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTA4H |
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Lap3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD |
Rabbit Polyclonal Anti-PIGK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV |
Rabbit Polyclonal Anti-GFPT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the N terminal of human GFPT2. Synthetic peptide located within the following region: DLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQ |
Rabbit Polyclonal Anti-GFPT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the middle region of human GFPT2. Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH |
USD 379.00
In Stock
Rabbit polyclonal Gamma-glutamyltransferase 4 (heavy chain, Cleaved-Thr472) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Gamma-glutamyltransferase 4. |
Anti-GGT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human gamma-glutamyltransferase 1 |
Rabbit Polyclonal Anti-KYNU Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Aminoacylase 1 (ACY1) mouse monoclonal antibody, clone AT1E2, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Aminoacylase 1 (ACY1) mouse monoclonal antibody, clone AT1E2, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | Biotin |
Goat Polyclonal Antibody against Monoglyceride Lipase
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDLPHLVNADGQY, from the internal region (near N-Terminus) of the protein sequence according to NP_009214.1; NP_001003794.1. |
Rabbit Polyclonal Anti-GFPT1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GFPT1 / GFAT antibody was raised against synthetic 12 amino acid peptide from N-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken (100%); Turkey, Platypus (92%). |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
USD 379.00
2 Weeks
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2C5
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700155 |
USD 379.00
2 Weeks
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6B5
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700155 |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
| Applications | FC |
| Reactivities | Human |
GGT5 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GGTLA1 |
L Kynurenine Hydrolase (KYNU) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human KYNU |
Leukotriene A4 hydrolase (LTA4H) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human LTA4H |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
Rabbit anti-LTA4H polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human Leukotriene A4 hydrolase. |
Mouse Anti-Human CD13 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Rabbit polyclonal Anti-GGTL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGTL3 antibody: synthetic peptide directed towards the C terminal of human GGTL3. Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC |
Rabbit Polyclonal Anti-UQCRC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |
Rabbit Polyclonal Anti-KYNU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KYNU antibody: synthetic peptide directed towards the N terminal of human KYNU. Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Protease
Pathways
- Metabolic pathways