HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HDAC2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human HDAC2. |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
Rabbit polyclonal HDAC2 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
HDAC2 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HDAC2 |
Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-HDAC1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HDAC1. |
Rabbit polyclonal anti-HDAC1 antibody, Loading control
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1. |
Rabbit Polyclonal Anti-HDAC1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HDAC1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human HDAC1. |
Rabbit polyclonal HDAC2 (Ser394) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-HDAC-1 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Anti-HDAC2 (Phospho-Ser394) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 394 (E-D-S(p)-G-D) derived from Human HDAC2. |
Modifications | Phospho-specific |
Anti-HDAC2 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 392~396 (E-D-S-G-D) derived from Human HDAC2. |
Rabbit Polyclonal HDAC1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC1 |
Rabbit Polyclonal HDAC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC2 |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal antibody to CtBP2 (C-terminal binding protein 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 197 and 417 of CtBP2 (Uniprot ID#P56545) |
Rabbit anti-HDAC2 (Phospho-Ser394) polyclonal antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanHDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D). |
Modifications | Phospho-specific |
Rabbit polyclonal HDAC2 (Ab-394) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HDAC2 around the phosphorylation site of Serine 394. |
Rabbit polyclonal HDAC1 Antibody (Center S423)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-430 amino acids from the Central region of human HDAC1. |
Rabbit Polyclonal HDAC1 (Ser421) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC1 around the phosphorylation site of Serine 421 |
Modifications | Phospho-specific |
Rabbit Polyclonal HDAC2 (Ser394) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC2 around the phosphorylation site of Serine 394 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE |
Rabbit polyclonal anti-CtBP2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CtBP2. |
Rabbit polyclonal HDAC1 Antibody(C-term)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 421-450 amino acids from the C-terminal region of human HDAC1. |
Mouse monoclonal HDAC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal HDAC1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human HDAC1. |
Rabbit Polyclonal HDAC2 (Ser394) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human HDAC2 around the phosphorylation site of Sersine 394. |
Modifications | Phospho-specific |
Mouse monoclonal anti-HDAC2 antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal HDAC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody was generated by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 1-5, 433-448 and 467-482 of human HDAC1 (Genbank Accession no. Q13547). |
Carrier-free (BSA/glycerol-free) HDAC1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC1 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC1 mouse monoclonal antibody, clone OTI6F11 (formerly 6F11)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC1 mouse monoclonal antibody, clone OTI5F9 (formerly 5F9)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTBP2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HDAC2 mouse monoclonal antibody, clone OTI7E10 (formerly 7E10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 9-300 amino acids of human histone deacetylase 1 |
Anti-HDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 469-482 amino acids of Human histone deacetylase 1 |
Anti-HDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 469-482 amino acids of Human histone deacetylase 1 |
Anti-HDAC2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 474-488 amino acids of Human histone deacetylase 2 |
Anti-HDAC2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 474-488 amino acids of Human histone deacetylase 2 |
Anti-CTBP2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2 |
Anti-CTBP2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2 |
Rabbit Polyclonal Anti-CTBP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CTBP2 |
HDAC1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HDAC1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |