Rabbit Polyclonal EGFR (Tyr1092) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1092 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1110) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1110 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1172) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1172 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1197) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1197 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr869) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 869 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal PDGFRa Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFRa |
Rabbit Polyclonal PDGFR beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta |
Rabbit Polyclonal PDGFR beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta |
Rabbit Polyclonal PDGFR beta (Tyr740) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta around the phosphorylation site of Tyrosine 740 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Phospho-PDGFR beta (Tyr1021) Antibody (Phospho-specific)
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta around the phosphorylation site of Tyrosine 1021 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PDGFRa (Tyr849) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
HTR2C rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-ADCY1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY1. |
Rabbit polyclonal EGFR (Ser1026) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of serine 1026 (F-S-SP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr678) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 678 (K-R-TP-L-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Connexin 43 (Ser367) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Connexin 43 around the phosphorylation site of Serine 367 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-HTR2B antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B. Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK |
Rabbit Polyclonal Anti-PDGFRB Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PDGFRB / PDGFR Beta antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human PDGFRB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Rabbit, Pig (100%); Mouse, Rat, Elephant, Horse (93%); Dog, Hamster, Panda (86%). |
Rabbit Polyclonal Anti-ADRB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
Rabbit Polyclonal Anti-GJD2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJD2 antibody: synthetic peptide directed towards the middle region of human GJD2. Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY |
Goat Polyclonal Antibody against HTR2C
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVENLELPVN, from the internal region of the protein sequence according to NP_000859.1. |
Rabbit polyclonal anti-DRD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internalof human DRD1. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-GRM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRM1. |
Rabbit polyclonal anti-EGFR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EGFR. |
Rabbit polyclonal EGFR (Tyr869) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 869 (K-E-YP-H-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Tyr1110) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1110 (P-V-YP-H-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ADCY4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY4. |
Rabbit polyclonal anti-EGFR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Rabbit Polyclonal EGFR (Ser1070) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human EGFR around the phosphorylation site of Sersine 1070. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GRM1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GRM1 / MGLUR1 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM1 / MGLUR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Elephant, Panda, Bovine, Rabbit (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Dog, Bat, Horse, Opossum (94%); Chicken, Platypus (88%); Xenopus (82%). |
Rabbit anti Connexin 43 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a segment of the 3rd cytoplasmic domain of human/rat connexin 43 protein. |
Rabbit anti mGluR1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti EGFR(pS1070) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti Connexin 43 (pS368) Polyclonal Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminal region with a phosphorylated Serine368 of human Connexin 43. |
Rabbit anti EGFR(pY1092) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1C8
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700470 |
Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Germany
Japan
United Kingdom
China
