Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Goat Polyclonal Antibody against LAT1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GAPDYENLQELN, from the C Terminus of the protein sequence according to NP_055202.1; NP_001014987.1; NP_001014989.1; NP_001014988.1. |
Rat Anti-Human/Mouse CD45R (B220) Purified (100 ug)
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti-LAT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LAT |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit polyclonal anti-FCGR2A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FCGR2A. |
Mouse Anti-Human CD45RA Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-PPAP2C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007 |
| Modifications | Phospho-specific |
Rabbit polyclonal CD32 (Phospho-Tyr292) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD32 around the phosphorylation site of tyrosine 292 (I-T-YP-S-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal LAT (Ab-255) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human LAT around the phosphorylation site of tyrosine 255. |
Rabbit polyclonal FCGR2C antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FCGR2C. |
Goat Polyclonal Antibody against CD32 / FCGR2B
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDALEEPDDQNRI, from the C Terminus of the protein sequence according to NP_003992.3; NP_001002273.1; NP_001002274.1; NP_001002275.1;. |
Mouse Monoclonal anti-LAT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Mouse monoclonal Anti-FCGR2 Clone KB61
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD64 (Fc gamma Receptor 1) Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD16 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human LAT Purified (25 ug)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD45RA Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD45RO Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal CD45R Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FCGR2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FCGR2C Antibody is: synthetic peptide directed towards the N-terminal region of Human FCGR2C. Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD |
Rabbit Polyclonal Anti-FCGR1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCGR1A antibody is: synthetic peptide directed towards the C-terminal region of Human FCGR1A. Synthetic peptide located within the following region: LKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVH |
Mouse monoclonal Anti-FCGR1 Clone 10.1
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-FCGR2 Clone 2ZC115
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-FCGR3 Clone DJ130c
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-PTPRC Clone C11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-PTPRC Clone HLe-1(2D1)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-CD45RO Clone UCH-L1
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-PTPRC Clone 2B11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-CD45RA Clone 4KB5
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-CD45RB Clone PD7/26
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-PTPRC Clone BU64
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD45/LCA Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein encoding aa 1119-1304 of human CD45. |
Mouse monoclonal Anti-CD45 Antibody Summary
| Reactivities | Cross-reacts with Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI13D7 (formerly 13D7)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
