Antibodies

View as table Download

Rabbit polyclonal antibody to CBFA2T2 (core-binding factor, runt domain, alpha subunit 2; translocated to, 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 401 and 604 of CBFA2T2 (Uniprot ID#O43439)

Rabbit polyclonal CBFA2T2 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CBFA2T2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human CBFA2T2.

MTGR1 (CBFA2T2) sheep polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen C terminal portion of recombinant protein

Rabbit polyclonal anti-Cbfa2t2 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cbfa2t2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND

Rabbit polyclonal anti-CBFA2T2H antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBFA2T2H antibody: synthetic peptide directed towards the middle region of mouse CBFA2T2H. Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS

Rabbit Polyclonal Anti-CBFA2T2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBFA2T2 antibody: synthetic peptide directed towards the N terminal of human CBFA2T2. Synthetic peptide located within the following region: AKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL

Rabbit Polyclonal Anti-NFATC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the middle region of human NFATC1. Synthetic peptide located within the following region: STLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVP

CBFA2T2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CBFA2T2

CBFA2T2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CBFA2T2

CBFA2T2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 325-604 of human CBFA2T2 (NP_005084.1).
Modifications Unmodified