Antibodies

View as table Download

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703
Modifications Phospho-specific

Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721.
Modifications Phospho-specific

Rabbit Polyclonal KIT Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human KIT.

Biotinylated Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Anti-KIT (phospho-Tyr936) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 936 (H-I-Y(p)-S-N) derived from Human c-Kit.
Modifications Phospho-specific

Rabbit Polyclonal c-Kit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Kit

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen peptide coupled to KLH

Rabbit anti-PDGFC polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Partial recombaint protein

Goat Polyclonal KIT/CD117 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1

Anti-KIT Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.719~723 (N-E-Y-M-D) derived from Human c-Kit.

Rabbit anti-BMP7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP7

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2

Pro-EGF Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (near the N terminus) (SRQERVCNIEKNVS)

Phospho-KIT-Y721 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y721 of human KIT
Modifications Phospho-specific

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS

Rabbit Polyclonal Anti-GDF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP

Rabbit anti CD117 (kit) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998.

Rabbit anti CD117/Kit (NT)/c-Kit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide derived from N-terminus of human Kit protein. This sequence is identical among human and dog origins.

Rabbit anti CD117/Kit (IN)/c-Kit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide derived from extracellular domain of Kit protein. This sequence is identical in human and dog origins.

Anti-EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Rabbit Polyclonal Anti-KIT Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIT

Rabbit Polyclonal Anti-PDGFC Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDGFC

Rabbit polyclonal anti-BMP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP2

Rabbit polyclonal anti-BMP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP2