Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit polyclonal Cytochrome P450 19A1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1. |
Rabbit Polyclonal Anti-HSD3B1 Antibody
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Rabbit Polyclonal Anti-STS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY |
Rabbit Polyclonal Anti-HSD17B1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD17B1 antibody: synthetic peptide directed towards the N terminal of human HSD17B1. Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA |
Rabbit Polyclonal Anti-SRD5A2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Goat Polyclonal Antibody against HSD11B1 / HDL
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CTSYNMDRFINK, from the C Terminus of the protein sequence according to NP_005516.1; NP_861420.1. |
Rabbit polyclonal antibody to HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 232 and 292 of HSD11B1 |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709) |
UGT1A9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A9 |
Rabbit anti-UGT2B7 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT2B7 |
Rabbit anti-HSD3B2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSD3B2 |
Rabbit polyclonal anti-HSD11B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HSD11B1. |
Rabbit anti-CYP19A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP19A1 |
Rabbit anti-HSD17B2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSD17B2 |
Rabbit anti-UGT1A4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A4 |
Rabbit Polyclonal Anti-HSD11B2 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD11B2 antibody: synthetic peptide directed towards the N terminal of human HSD11B2. Synthetic peptide located within the following region: ERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRL |
Rabbit Polyclonal Anti-UGT1A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A6 antibody: synthetic peptide directed towards the C terminal of human UGT1A6. Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK |
Rabbit Polyclonal Anti-STS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STS antibody: synthetic peptide directed towards the C terminal of human STS. Synthetic peptide located within the following region: LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW |
Rabbit Polyclonal Anti-UGT2B15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
Rabbit Polyclonal Anti-TRMT11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11. Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP |
Rabbit Polyclonal Anti-SULT2B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the middle region of human SULT2B1. Synthetic peptide located within the following region: YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI |
Rabbit Polyclonal Anti-SULT2B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the C terminal of human SULT2B1. Synthetic peptide located within the following region: NTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM |
Rabbit Polyclonal Anti-SULT1E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SULT1E1 antibody: synthetic peptide directed towards the middle region of human SULT1E1. Synthetic peptide located within the following region: LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY |
Rabbit Polyclonal Anti-LCMT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
Rabbit Polyclonal Anti-METTL2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE |
Rabbit Polyclonal Anti-METTL2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS |
Rabbit Polyclonal Anti-LCMT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LCMT1 |
Rabbit Polyclonal Antibody against Aromatase
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human aromatase protein sequence (between residues 400-502). |
Rabbit polyclonal antibody to HSD3a (aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 217 of HSD3a (Uniprot ID#P17516) |
Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224) |
Rabbit polyclonal Cytochrome P450 11B1/2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 11B1/2. |
Rabbit Polyclonal TYW4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4. |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR |
Rabbit Polyclonal Anti-SRD5A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRD5A3 antibody: synthetic peptide directed towards the N terminal of human SRD5A3. Synthetic peptide located within the following region: GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN |
Rabbit Polyclonal Anti-CYP11B1 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
Goat Polyclonal Antibody against SRD5A2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QVQCQQSPVLAG, from the N Terminus of the protein sequence according to NP_000339. |
Goat Polyclonal Antibody against AKR1C4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DPKYQRVELNDGH-C, from the N Terminus of the protein sequence according to NP_001809.2. |
Rabbit polyclonal Anti-UGT1A7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN |
Rabbit Polyclonal Anti-HSD3B2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH |
Rabbit Polyclonal Anti-HSD11B1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI |
Goat Polyclonal Antibody against Aromatase / CYP19A1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HDLSLHPDETKN, from the internal region of the protein sequence according to NP_000094.2; NP_112503.1. |
Goat Polyclonal Antibody against HSD3B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DRHKETLKSKTQ, from the C Terminus of the protein sequence according to NP_000853.1. |
Goat Polyclonal Antibody against STS
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QAGQKIDEPTSN, from the internal region of the protein sequence according to NP_000342.2. |
Goat Anti-SRD5A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KMFEDYPKSRK, from the C Terminus of the protein sequence according to NP_000339.2. |
Rabbit polyclonal anti-TRMT11 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TRMT11. |
Rabbit polyclonal anti-Estrogen Sulfotransferase antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 195 of human Estrogen Sulfotransferase (EST) |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |