Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-CCL2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 75-89 amino acids of Human C-C motif chemokine 2 |
Anti-TRAF6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase |
Anti-MAPK8 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 376-389 amino acids of Human mitogen-activated protein kinase 8 |
Anti-MAPK9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 373-386 amino acids of Human mitogen-activated protein kinase 9 |
Anti-NFKB1p105 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 350 amino acid of Human Nuclear factor NF-kappa-B p105 subunit |
Anti-HSP90B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 315 amino acids of human heat shock protein 90kDa beta (Grp94), member 1 |
Anti-NLRP3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-301 amino acids of human NLR family, pyrin domain containing 3 |
Anti-MAPK8 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human mitogen-activated protein kinase 8 |
Rabbit Polyclonal Anti-IKBKG Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IKBKG |
Rabbit Polyclonal Anti-CARD9 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CARD9 |
Rabbit Polyclonal Anti-TAB3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TAB3 |
Rabbit Polyclonal Anti-MAPK12 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAPK12 |
Rabbit Polyclonal Anti-TRIP6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIP6 |
Rabbit Polyclonal Anti-CHUK Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CHUK |
Rabbit Polyclonal Anti-MAPK11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPK11 |
Rabbit Polyclonal Anti-MAPK13 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPK13 |
Rabbit Polyclonal Anti-NOD2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NOD2 |
Rabbit Polyclonal Anti-CARD6 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CARD6 |
Rabbit Polyclonal Anti-NAIP Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NAIP |
Rabbit Polyclonal Anti-TAB1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TAB1 |
Rabbit Polyclonal Anti-HPD Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human XIAP |
CASP5 Antibody - middle region
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CASP5 |
TNFAIP3 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP |
PSTPIP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAPK12 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAPK12 |
RELA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human RELA (NP_068810). The exact sequence is proprietary. |
RELA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human RELA (NP_068810). The exact sequence is proprietary. |
Active filters
Clonalities
- Polyclonal
Pathways
- NOD-like receptor signaling pathway
Filter by
Category
Target Symbol
- RELA (52)
- CHUK (25)
- MAPK14 (25)
- NFKB1 (23)
- MAPK8 (21)
- NFKBIA (20)
- IKBKG (19)
- CASP8 (17)
- HSP90AB1 (17)
- IKBKB (17)
- CASP1 (16)
- MAPK3 (15)
- MAPK1 (14)
- IL6 (13)
- NFKBIB (13)
- HSP90B1 (12)
- MAP3K7 (12)
- TNF (12)
- IL1B (11)
- CCL2 (10)
- HSP90AA1 (10)
- TRAF6 (10)
- CASP5 (8)
- NLRP3 (8)
- RIPK2 (8)
- TNFAIP3 (8)
- NOD1 (7)
- PYCARD (7)
- XIAP (7)
- CXCL1 (6)
- TAB1 (6)
- BIRC2 (5)
- CARD8 (5)
- CCL11 (5)
- CCL5 (5)
- CCL7 (5)
- CXCL8 (5)
- MAPK9 (5)
- NLRC4 (5)
- NOD2 (5)
- TRIP6 (5)
- BIRC3 (4)
- CARD6 (4)
- IL18 (4)
- MAPK10 (4)
- MAPK12 (4)
- TAB2 (4)
- CARD9 (3)
- CCL8 (3)
- CXCL2 (3)
- NAIP (3)
- PSTPIP1 (3)
- CCL13 (2)
- MAPK11 (2)
- MEFV (2)
- NLRP1 (2)
- TAB3 (2)
- MAPK13 (1)
- SUGT1 (1)
Reactivities
- Human (443)
- Mouse (284)
- Rat (231)
- Bovine (11)
- Monkey (10)
- Chicken (7)
- Pig (6)
- Primate (6)
- Cow (4)
- Dog (3)
- Hamster (3)
- Rabbit (3)
- Rhesus Monkey (3)
- Canine (2)
- Canis (2)
- Drosophila (2)
- C. elegans (1)
- Chimpanzee (1)
- Equine (1)
- Gerbil (1)
- Guinea Pig (1)
- Sheep (1)
- Tobacco hornworm (1)
- Xenopus (1)
- Zebrafish (1)