Rabbit Polyclonal Anti-PNPLA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
PAH Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PAH |
Rabbit Polyclonal Anti-DDC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Goat Polyclonal Antibody against GOT1 (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Rabbit Polyclonal Anti-PRDX6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Rabbit anti-MIF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MIF |
Rabbit Polyclonal Anti-DDC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC. Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL |
Rabbit Polyclonal Anti-HPD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPD antibody: synthetic peptide directed towards the middle region of human HPD. Synthetic peptide located within the following region: EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV |
Rabbit Polyclonal Anti-PRDX6 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD |
Rabbit Polyclonal Anti-ARD1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARD1A antibody: synthetic peptide directed towards the middle region of human ARD1A. Synthetic peptide located within the following region: VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE |
Rabbit Polyclonal Anti-NAT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6. Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP |
Goat Anti-AOC3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1. |
Rabbit polyclonal anti-IL4I1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1. |
Rabbit polyclonal AOC3 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3. |
Rabbit Polyclonal Anti-LYCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Rabbit Polyclonal ALDH3B1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal TAT Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Polyclonal Antibody against GOT2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNLKKEGSTHNWQH, from the internal region of the protein sequence according to NP_002071.2. |
Goat Anti-Phenylalanine Hydroxylase (PAH) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ESRPSRLKKDE, from the internal region of the protein sequence according to NP_000268.1. |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA |
Rabbit Polyclonal Anti-ALDH3A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the C terminal of human ALDH3A1. Synthetic peptide located within the following region: KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI |
Rabbit Polyclonal Anti-ALDH3A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI |
Goat Polyclonal Antibody against DOPA decarboxylase
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-WEHIKELAADVL, from the C Terminus of the protein sequence according to NP_000781.1. |
Goat Polyclonal Antibody against MAOB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Goat Polyclonal Antibody against Monoamine Oxidase A
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1. |
Goat Polyclonal Antibody against GOT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1. |
Goat Polyclonal Antibody against GOT2 (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CKDADEAKRVES, from the internal region of the protein sequence according to NP_002071.2. |
Rabbit Polyclonal Aldh3A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1. |
Rabbit Polyclonal antibody to FUS2 (N-acetyltransferase 6 (GCN5-related))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 224 and 286 of FUS2 (Uniprot ID#Q93015) |
Goat Anti-ALDH3B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDLHKSAFESEVSE, from the internal region of the protein sequence according to NP_000685.1. |
Chicken polyclonal anti-MIF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgY fraction antibody was prepared from eggs of chickens laid after repeated immunizations with a synthetic peptide corresponding to aa 2-32 of Human MIF conjugated to keyhole limpet hemocyanin (KLH). MIF is a proinflammatory cytokine that plays an important role in systemic inflammatory events. |
Goat Anti-peroxiredoxin 6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EANTTVGRIRFHD, from the internal region (near N terminus) of the protein sequence according to NP_004896.1. |
GOT2 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (QGYRYYDPKTCGFD) |
Germany
Japan
United Kingdom
China
