Rabbit Polyclonal RIG-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIG-1 antibody was raised against human GST-tagged RIG-1 protein. |
Rabbit Polyclonal RIG-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIG-1 antibody was raised against human GST-tagged RIG-1 protein. |
DDX58 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDX58 |
Anti-DDX58 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 909-925 amino acids of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 |
DDX58 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human DDX58 |
DDX58 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDX58 |
DDX58 goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthetic peptide from human DDX58 / RIG-1 / RIG-I |
DDX58 goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | DDX58 antibody was raised against synthetic peptide from human DDX58 / RIG-1 / RIG-I |
Rabbit Polyclonal Anti-DDX58 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDX58 antibody: synthetic peptide directed towards the middle region of human DDX58. Synthetic peptide located within the following region: EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH |
Rabbit Polyclonal Anti-DDX58 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDX58 |
DDX58 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DDX58 |
DDX58 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDX58 |
RIG-I / DDX58 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 726-925 of human RIG-I / DDX58 (NP_055129.2). |
Modifications | Unmodified |
Rabbit polyclonal anti-DDX58 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DDX58 |
Rabbit polyclonal anti-DDX58 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DDX58 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".