Rabbit anti-RACGAP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RACGAP1 |
Rabbit anti-RACGAP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RACGAP1 |
Rabbit Polyclonal antibody to RACGAP1 (Rac GTPase activating protein 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RACGAP1 (Uniprot ID#Q9H0H5) |
RACGAP1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 30-58 amino acids from the N-terminal region of Human RACGAP1 |
Goat Polyclonal Antibody against RACGAP1 / MgcRacGAP
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GRQGNFFASPMLK, from the C Terminus of the protein sequence according to NP_037409.1. |
Rabbit Polyclonal Anti-Racgap1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Racgap1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Racgap1. Synthetic peptide located within the following region: GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF |
RACGAP1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal GTPase Activating Protein Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein |
Rabbit Polyclonal GTPase Activating Protein (Ser387) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GTPase Activating Protein around the phosphorylation site of Serine 387 |
Modifications | Phospho-specific |
Rabbit polyclonal GTPase Activating Protein antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RGAP1. |
Rabbit Polyclonal Anti-RACGAP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: EILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALD |
Rabbit Polyclonal Anti-RACGAP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RACGAP1 antibody: synthetic peptide directed towards the N terminal of human RACGAP1. Synthetic peptide located within the following region: KREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGG |
Rabbit Polyclonal Anti-CBFA2T2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBFA2T2 antibody: synthetic peptide directed towards the middle region of human CBFA2T2. Synthetic peptide located within the following region: GQGRPLLPVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNG |
Rabbit polyclonal anti-pS157 HsCyk-4 (MgcRacGAP and RacGAP1) antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | pS157 HsCyk-4 (MgcRacGAP and RacGAP1) |