ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
VDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VDAC1 |
Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796) |
Rabbit Polyclonal Anti-NOX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2. |
Rabbit Polyclonal Anti-KCNH6 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNH6 |
Rabbit Polyclonal Anti-ANGPTL3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ANGPTL3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ANGPTL3. |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
Rabbit polyclonal SCNN1A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SCNN1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-391 amino acids from the Central region of human SCNN1A. |
Rabbit anti-TPCN2 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | raised was raised against a peptide from N terminal residues of human TPCN2 protein |
Goat Anti-NOX1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1. |
Rabbit polyclonal Anti-KCNAB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Goat Anti-CYBB / GP91-PHOX Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SYLNFARKRIKNP, from the internal region of the protein sequence according to NP_000388.2. |
Rabbit polyclonal Connexin 43 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Connexin 43. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-NOX1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Rabbit Polyclonal CLNS1A Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to CLIC3 (chloride intracellular channel 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 236 of CLIC3 (Uniprot ID#O95833) |
Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit anti-CLCN1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLCN1 |
Rabbit Polyclonal Anti-VDAC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
Goat Polyclonal Anti-ASIC1 Antibody
Applications | WB |
Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ASIC1 Antibody: Peptide with sequence C-NILPHHPARGT, from the C Terminus of the protein sequence according to NP_064423.2; NP_001086.2; NP_001243759.1. |
Kv beta 1 (KCNAB1) mouse monoclonal antibody, clone K47/42
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Kv beta 1 (KCNAB1) mouse monoclonal antibody, clone K47/42
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CLIC4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CLIC4 antibody is generated from rabbits immunized with recombinant human CLIC4 protein. |
Goat Anti-CLCA1 (aa872-884) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PETPSPDETSAPC, from the internal region of the protein sequence according to NP_001276.2. |
Rabbit polyclonal antibody to SCNN1A (sodium channel, nonvoltage-gated 1 alpha)
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 459 of SCNN1A (Uniprot ID#P37088) |
Mouse Monoclonal anti-CACNB2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-CLCN7 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLCN7. |
Rabbit polyclonal anti-SCNN1D antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SCNN1D. |
Rabbit polyclonal anti-NOX5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5. |
ENaC Gamma Goat Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide C-SNQLTDTQMLDE from the C-terminus of human SCNN1G (NP_001030.2). Percent identity by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey (92%); Elephant (83%). |
Rabbit polyclonal CACNA2D2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CLC4 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CLC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 663-689 amino acids from the C-terminal region of human CLC4. |
Rabbit polyclonal CLIC4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLIC4. |
Goat Anti-CLIC1 / NCC27 (aa45-57) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TVDTKRRTETVQK, from the internal region of the protein sequence according to NP_001279.2. |
Rabbit Polyclonal Anti-Connexin-43
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HAQPFDFPDDNQNSK, corresponding to amino acids residues 331-345 of human Connexin-43. Intracellular, C-terminus. |
Rabbit anti-GJA4 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GJA4 |
Rabbit anti-CLCN5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLCN5 |
Rabbit anti-BEST1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BEST1 |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Rabbit Polyclonal Anti-Connexin 26 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |
Rabbit Polyclonal Anti-Connexin 32 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |
Rabbit Polyclonal Anti-AQP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AQP1 Antibody: A synthesized peptide derived from human AQP1 |
Rabbit Polyclonal Anti-Connexin 43 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Anti-GJB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GJB2 antibody was raised against a 16 amino acid peptide near the center of human GJB2. |
Rabbit Polyclonal Anti-Trophinin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Trophinin antibody was raised against a 16 amino acid peptide near the amino terminus of human Trophinin. |
Rabbit Polyclonal Anti-TNFAIP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TNFAIP1 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TNFAIP1. |