Goat Polyclonal Anti-HIF1a Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Goat Polyclonal Anti-HIF1a Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)
Applications | IHC, IP, WB |
Reactivities | Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep |
Conjugation | Unconjugated |
Rabbit polyclonal HIF1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Hamster |
Conjugation | Unconjugated |
Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal HIF1A antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human HIF1A |
Goat Polyclonal Anti-HIF1a Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 470 to 590 aa of human HIF1a produced in E. coli. |
Rabbit Polyclonal Anti-EIF4E2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
Conjugation | Unconjugated |
Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal Antibody against EIF4E2 (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EIF4E2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human EIF4E2. |
Rabbit polyclonal Hif-1 alpha hydroxy P564 antibody
Applications | WB |
Reactivities | Bovine, Human, Monkey, Mouse, Rat, Xenopus, Dog |
Conjugation | Unconjugated |
Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region surrounding the P564 of human HIF-1a. |
Mouse Monoclonal HIF-1 alpha Antibody (ESEE122)
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
Conjugation | Unconjugated |
Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit polyclonal HMGN phospho S20/S24 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-28 of human HMGN protein (see below). |
Mouse Monoclonal Anti-HIF1 alpha Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Cow |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-HIF1A antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the N terminal of human HIF1A. Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS |
Rabbit Polyclonal Anti-HIF1A Antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | Genomic sequence made to an internal portion of human HIF-1 alpha (within residues 400-550). [Swiss-Prot# Q16665] |
Mouse Monoclonal HIF-1 alpha Antibody (HA111)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal HIF-1 alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | Fusion protein containing amino acids 432-528 of human HIF-1 alpha [UniProt# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 9] Antibody (exon 9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 350-400). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 10] Antibody (exon 10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 400-450). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 12] Antibody (exon 12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 550-600). [Swiss-Prot# Q16665] |
Rabbit Polyclonal HIF-1 alpha [Exon 13] Antibody (exon 13)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 700-750). [Swiss-Prot# Q16665] |
Rabbit anti HIF, alpha Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A twenty-one amino acids synthetic peptide corresponding to the internal sequence of HIF alpha protein. This sequence is identical to human, rat and mouse origins. |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HIF1A mouse monoclonal antibody,clone OTI2D5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HIF1A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HIF1A |
EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI5D11 (formerly 5D11)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
EIF4E2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
HIF1A mouse monoclonal antibody,clone OTI2D5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HIF1A mouse monoclonal antibody,clone OTI2D5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |