EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3C2-4
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3G11-14
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 4A5-19
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5F4-15
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5G12-21
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6F5-23
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6H8-22
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8E8-2
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8F6-6
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 9G5-20
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 12G4-15
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 15C4-8
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 16F12-11
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal ERBB2 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ErbB2 antibody is generated from rabbits immunized with human recombinant ErbB2 protein. |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
FGFR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGFR1 |
Rabbit anti-FGFR2 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human FGFR2 |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
Modifications | Phospho-specific |
BCL2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human BCL2 |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
ERBB2 Capture mouse monoclonal antibody, Luminex validated, clone OTI4F10
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700208 |
Rabbit anti-PDGFRB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SRD5A2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
ERBB2 Capture mouse monoclonal antibody, Luminex validated, clone OTI12G4
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700215 |
Rabbit Polyclonal IGF1 Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human IGF1R protein (between residues 700-800) [UniProt P08069] |
Rabbit polyclonal anti-PDGFR a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDGFR a. |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against FGFR1 (Y766)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FGFR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 744-773 amino acids from human FGFR1. |
Goat Polyclonal Antibody against BCL2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648. |
Rabbit Polyclonal Bcl-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bcl-2 antibody was raised against a peptide corresponding to 15 amino acids near the N-terminus of human Bcl-2. |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
ERBB2 Capture mouse monoclonal antibody, Luminex validated, clone OTI3F11
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700241 |
FGFR2 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3B3
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700364 |
FGFR2 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5F7
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700365 |
Goat Polyclonal Anti-ERBB2 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli. |
Rabbit polyclonal IGF1R (Ab-1346) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
Modifications | Phospho-specific |
Rabbit polyclonal HER2 (Tyr877) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HER2 around the phosphorylation site of Tyrosine 877 (T-E-YP-H-A). |
Modifications | Phospho-specific |
Rabbit polyclonal FGFR1 (Ab-766) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human FGFR1 around the phosphorylation site of tyrosine 766 (Q-E-YP-L-D). |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
Modifications | Phospho-specific |
Rabbit polyclonal ERBB2 Antibody(N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ERBB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 21-52 amino acids from the N-terminal region of human ERBB2. |
Rabbit polyclonal PDGFRB Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PDGFRB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-72 amino acids from the N-terminal region of human PDGFRB. |
Rabbit polyclonal FGFR2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human FGFR2. |
Rabbit Polyclonal Phospho-HER2 (Tyr1248) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HER2 around the phosphorylation site of Tyrosine 1248 |
Modifications | Phospho-specific |
Rabbit Polyclonal HER2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HER2 |
Rabbit Polyclonal Anti-FGFR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGFR2 Antibody: A synthesized peptide derived from human FGFR2 |