Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-MGST3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MGST3. |
Antibodies
View as table Download
Anti-GGT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human gamma-glutamyltransferase 1 |
Rabbit polyclonal GSTO1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-155 amino acids from the Central region of human GSTO1. |
Rabbit polyclonal GSTP1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1. |
Rabbit polyclonal GSTM1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1. |
Goat Polyclonal Antibody against GPX2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SLDGEKVDFN, from the internal region of the protein sequence according to NP_002074.2. |
Rabbit polyclonal anti-RRM2B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RRM2B. |
Rabbit polyclonal RRM2B p53R2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Human RRM2B/p53R2 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human RRM2B1 protein. A residue of cysteine was added to facilitate coupling. |
Rabbit polyclonal GSTT1 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GSTT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-34 amino acids from the N-terminal region of human GSTT1. |
Rabbit Polyclonal Anti-GCLM Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ |
Rabbit Polyclonal Anti-GSTM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTM3 Antibody: synthetic peptide directed towards the middle region of human GSTM3. Synthetic peptide located within the following region: EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-MGST1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGST1 antibody: synthetic peptide directed towards the N terminal of human MGST1. Synthetic peptide located within the following region: NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL |
Rabbit Polyclonal Anti-MGST3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGST3 antibody: synthetic peptide directed towards the N terminal of human MGST3. Synthetic peptide located within the following region: LAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFF |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
USD 379.00
2 Weeks
USD 379.00
2 Weeks
USD 379.00
2 Weeks
Goat Polyclonal Antibody against GST3 / GSTP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LADQGQSWKEEV, from the internal region of the protein sequence according to NP_000843.1. |
Goat Polyclonal Antibody against GSTM1 / GSTM2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CVFSKMAVWGNK, from the C Terminus of the protein sequence according to NP_000552; NP_666533; NP_000839. |
Goat Polyclonal Antibody against GPX7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CNQFGQQEPDSNK, from the internal region of the protein sequence according to NP_056511.2. |
Goat Polyclonal Antibody against G6PD
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KPASTNSDDVRDEK, from the internal region of the protein sequence according to NP_000393.4 ; NP_001035810.1. |
Goat Polyclonal Antibody against G6PD (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-STNSDDVRDEKVK, from the internal region of the protein sequence according to NP_000393.4 ; NP_001035810.1. |
Rabbit polyclonal antibody to ODC (ornithine decarboxylase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 180 and 461 of ODC (Uniprot ID#P11926) |
Rabbit Polyclonal IDH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IDH1 antibody was raised against a 13 amino acid synthetic peptide near the carboxy terminus of human IDH1. |
Mouse Anti-Human CD13 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-GSTT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-GSTM2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-GSS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
GSTO1 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Internal region (near C terminus) (KEDPTVSALLTSEKD) |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Rabbit polyclonal Anti-GSTZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTZ1 antibody: synthetic peptide directed towards the N terminal of human GSTZ1. Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF |
Rabbit polyclonal Anti-GSTA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5. Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE |
Rabbit polyclonal Anti-GGTL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGTL3 antibody: synthetic peptide directed towards the C terminal of human GGTL3. Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC |
Rabbit polyclonal Anti-GSTO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTO2 antibody: synthetic peptide directed towards the N terminal of human GSTO2. Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV |
Rabbit Polyclonal Anti-GSTK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the N terminal of human GSTK1. Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK |
Rabbit Polyclonal Anti-GSTK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the middle region of human GSTK1. Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL |
Rabbit Polyclonal Anti-GCLC Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCLC antibody: synthetic peptide directed towards the N terminal of human GCLC. Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN |
Rabbit Polyclonal Anti-GCLC Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCLC antibody: synthetic peptide directed towards the middle region of human GCLC. Synthetic peptide located within the following region: RISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQEGIDHLLAQHVA |
Rabbit Polyclonal Anti-GSTM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSTM3 Antibody: synthetic peptide directed towards the middle region of human GSTM3. Synthetic peptide located within the following region: SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF |
Active filters
Conjugates
- Unconjugated
Pathways
- Glutathione metabolism
Filter by
Category
Target Symbol
- RRM1 (36)
- SMS (34)
- GSTT2 (30)
- GSTO2 (20)
- ANPEP (19)
- IDH1 (18)
- GSS (16)
- GSTP1 (13)
- GSTA4 (9)
- ODC1 (9)
- RRM2 (8)
- GSTZ1 (7)
- GCLM (6)
- GSTT1 (6)
- PGD (6)
- G6PD (5)
- GCLC (5)
- GSTM1 (5)
- IDH2 (5)
- GGT1 (4)
- GSTO1 (4)
- MGST1 (4)
- GPX2 (3)
- GPX4 (3)
- GSR (3)
- RRM2B (3)
- GGT7 (2)
- GPX3 (2)
- GPX7 (2)
- GSTA1 (2)
- GSTA2 (2)
- GSTA3 (2)
- GSTK1 (2)
- GSTM2 (2)
- GSTM3 (2)
- LAP3 (2)
- MGST2 (2)
- MGST3 (2)
- GGCT (1)
- GPX1 (1)
- GSTA5 (1)
- GSTM5 (1)