Rabbit anti-NR1I3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NR1I3 |
Rabbit anti-NR1I3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NR1I3 |
Rabbit polyclonal anti-NR1I3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I3. |
Rabbit Polyclonal Anti-NR1I3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3. Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA |
Rabbit Polyclonal Anti-NR1I3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3. Synthetic peptide located within the following region: PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG |
Rabbit Polyclonal Anti-NR1I3 Antibody
Applications | IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of mouse NR1I3. Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS |
Rabbit Polyclonal Anti-NR1I3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of human NR1I3. Synthetic peptide located within the following region: FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQS |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI9E4 (formerly 9E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI9E1 (formerly 9E1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) NR1I3 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NR1I3 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse NR1I3 |
NR1I3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR1I3 |
NR1I3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR1I3 |
NR1I3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NR1I3. |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI9E4 (formerly 9E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI9E4 (formerly 9E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI10F9 (formerly 10F9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI10B1 (formerly 10B1)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI9E1 (formerly 9E1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI9E1 (formerly 9E1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
NR1I3 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
NR1I3 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |