Germany
Japan
United Kingdom
China
Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
Antibodies
View as table Download
Goat Polyclonal Antibody against Fumarase / FH
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HPNDHVNKSQSSND, from the internal region of the protein sequence according to NP_000134.2. |
Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 293 of the human Pyruvate Dehydrogenase E1-alpha subunit protein. [Swiss-Prot #P08559] |
Mouse Monoclonal pyruvate dehydrogenase (lipoamide) alpha 1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MDH1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human MDH1 |
MDH2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human MDH2 |
PDHA1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 233~263 amino acids from the Central region of Human PDHA1 |
Goat Polyclonal Antibody against Pyruvate Carboxylase
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KFKEVKKAYVEANQ, from the internal region of the protein sequence according to NP_000911.2; NP_001035806.1; NP_071504.2. |
Goat Polyclonal Antibody against SDHB
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATYKEKKASV, from the C Terminus of the protein sequence according to NP_002991.1. |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Rabbit polyclonal anti-PEPCK-C antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surroundign amino acid 507 of mouse PEPCK-C |
Anti-PDHA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1 |
Rabbit polyclonal SDHA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SDHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 577-605 amino acids from the C-terminal region of human SDHA. |
Rabbit Polyclonal anti-ACLY antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI |
Rabbit Polyclonal anti-ACLY antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the N terminal of human PCK1. Synthetic peptide located within the following region: PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit Polyclonal Anti-PC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL |
Carrier-free (BSA/glycerol-free) ACLY mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Anti-PC Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase |
Anti-PC Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase |
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Anti-ACO1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Rabbit Polyclonal Anti-ACLY Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACLY |
Rabbit Polyclonal Anti-ACLY Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACLY |
Rabbit Polyclonal Anti-MDH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MDH1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Druggable Genome
Pathways
- Citrate cycle (TCA cycle)