Rabbit anti-CXCR3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CXCR3 |
Rabbit anti-CXCR3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CXCR3 |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit Polyclonal CXCR4 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human, Gorilla |
Conjugation | Unconjugated |
Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
Rabbit Polyclonal CCR3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3. |
Rabbit Polyclonal CCR5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit Polyclonal Anti-CXCR4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
Modifications | Phospho-specific |
CX3CR1 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A peptide corresponding to amino acids 2-21 of Human CX3CR1. |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a peptide corresponding to amino acids in a extracellular loop of human CX3CR1. The sequence is identical to that of rat CX3CR1 and differs from that of mouse CX3CR1 by one amino acid (3,4). |
Rabbit Polyclonal Bonzo Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33. The sequence of this peptide differs from those of African green monkey and pig-tailed macaque by one or two amino acids, respectively,. |
CCR6 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | CCR6 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Horse (80%). |
CCR4 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%). |
Anti-CCR3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 10-25 amino acids of human chemokine (C-C motif) receptor 3 |
Rabbit Polyclonal Anti-CCR4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL |
Rabbit Polyclonal Anti-IL8RB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
Rabbit Polyclonal Anti-CCR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7 |
Rabbit Polyclonal Anti-CCR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7 |
Rabbit Polyclonal Anti-Phospho-CCR5(Ser349) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-CCR5(Ser349) Antibody: A synthesized peptide derived from human CCR5 around the phosphorylation site of Sersine 349 |
Modifications | Phospho-specific |
Rabbit Polyclonal CXCR4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CXCR2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human |
Immunogen | Synthetic peptide mapping at the middle region of human CXCR2 |
CCR5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of Human CCR5 |
CCR6 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human CCR6 |
Rabbit Polyclonal CXCR4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit Polyclonal CXCR4-Lo Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a. |
Rabbit polyclonal CCR5 (Ser349) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 349 (E-I-SP-V-G). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CCR7 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCR7. |
CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%). |
Rabbit Polyclonal CCR5 (Ser336) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 around the phosphorylation site of Serine 336 |
Modifications | Phospho-specific |
Rabbit Polyclonal CXCR3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CXCR3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human CXCR3 |
Rabbit Polyclonal CCR7 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR7 antibody was raised against a 15 amino acid peptide near the center of human CCR7. |
Rabbit Polyclonal CCR5 Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 |
CX3CR1 (175-189) rabbit polyclonal antibody, Purified
Applications | IF, WB |
Reactivities | Human |
Immunogen | Peptide corresponding to amino acids 175 to 189 of human CX3CR1. |
CCR7 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence mapping at the C-terminal of human CCR7 |
CXCR4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human CXCR4 |
Rabbit polyclonal anti-CX3CR1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CX3CR1. |
Rabbit polyclonal anti-CXCR3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXCR3. |
CCR1 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | CCR1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Bovine (95%); Mouse (85%); Marmoset (80%). |
Rabbit Polyclonal CCR3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CCR3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human CCR3. |
Rabbit Polyclonal Bonzo Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids 319 to 338 of human origin. The sequence of this peptide is identical to those of macaque and African green monkey. |
Rabbit Polyclonal CCR8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop. |
Rabbit polyclonal CCR5 (Ser336) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 336 (R-A-SP-S-V). |
Modifications | Phospho-specific |
CCR1 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | CCR1 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human CCR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Hamster (89%); Marmoset, Mouse (83%). |
CXCR1 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human |
Immunogen | CXCR1 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan, Monkey, Marmoset (94%); Gibbon, Rabbit (88%). |
XCR1 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | XCR1 antibody was raised against synthetic 20 amino acid peptide from C-terminal cytoplasmic domain of human XCR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon (95%); Monkey (90%). |
CCR3 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | CCR3 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human CCR3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (88%). |
Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CXCR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCR6 antibody: synthetic peptide directed towards the N terminal of human CXCR6. Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL |
Rabbit Polyclonal Anti-CCR8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |
Goat Anti-CXCR1 (aa26-38) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DYSPCMLETETLN, from the internal region (near N terminus) of the protein sequence according to NP_000625.1. |