Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 488 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 488 |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight633 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 633 |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 550 conjugated
| Reactivities | Human, Mouse |
| Conjugation | DyLight 550 |
Anti-LGR5 mouse mAb, clone OTI2A2, HRP conjugated
| Reactivities | Human, Mouse |
| Conjugation | HRP |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit polyclonal anti-SPR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Rabbit Polyclonal Antibody against OPRS1 (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This OPRS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 47-81 amino acids from the N-terminal region of human OPRS1. |
Rabbit polyclonal anti-MTR1A antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MTR1A. |
Rabbit polyclonal anti-GPR126 antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR126. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-Melanocortin Receptor 4 (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)HRGMHTSLHLWNRSS, corresponding to amino acid residues 6-20 of human MC4R. Extracellular, N terminal. |
Rabbit Polyclonal Anti-AGTR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
Goat Polyclonal Anti-CB1 (isoform a) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CB1 (isoform a) Antibody: Peptide with sequence SNDIQYEDIKGDMAS-C, from the N Terminus of the protein sequence according to NP_057167.2. |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor. |
Goat Anti-ADRA2A Antibody
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TERRPNGLGPERS, from the internal region of the protein sequence according to NP_000672.2. |
Goat Anti-S1PR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NYTKETLETQ, from the internal region of the protein sequence according to NP_004221.3. |
Active filters
Reactivities
- Mouse
Families
- GPCR
Filter by
Category
Target Symbol
- LGR5 (79)
- GPR17 (37)
- GPR83 (17)
- SSTR3 (12)
- LGR4 (11)
- GPR26 (10)
- GRM4 (9)
- SSTR4 (8)
- ADRA1B (7)
- CASR (7)
- CHRM1 (7)
- CXCR4 (7)
- GRM1 (7)
- GRM3 (7)
- CXCR3 (6)
- GRM2 (6)
- LPAR1 (6)
- P2RY2 (6)
- SSTR1 (6)
- AGTR1 (5)
- FZD4 (5)
- GABBR1 (5)
- GRM7 (5)
- HTR1A (5)
- HTR2C (5)
- MC4R (5)
- MTNR1A (5)
- NPY1R (5)
- S1PR1 (5)
- SSTR2 (5)
- ADRA2A (4)
- ADRA2C (4)
- AGTR2 (4)
- APLNR (4)
- CCR3 (4)
- CCR5 (4)
- CX3CR1 (4)
- EDNRA (4)
- FZD3 (4)
- GLP1R (4)
- GRM5 (4)
- GRM8 (4)
- GRPR (4)
- HCRTR1 (4)
- HTR4 (4)
- HTR7 (4)
- LPAR4 (4)
- MC5R (4)
- RXFP3 (4)
- SIGMAR1 (4)
- TACR1 (4)
- ADRB1 (3)
- ADRB2 (3)
- BDKRB2 (3)
- CCKBR (3)
- CHRM2 (3)
- CXCR2 (3)
- DRD1 (3)
- DRD4 (3)
- F2R (3)
- FPR2 (3)
- FSHR (3)
- FZD1 (3)
- FZD10 (3)
- FZD2 (3)
- GNRHR (3)
- GPR15 (3)
- GPR173 (3)
- GPR3 (3)
- GPR4 (3)
- GPR68 (3)
- HTR1F (3)
- LPAR3 (3)
- MC2R (3)
- NTSR1 (3)
- OPRL1 (3)
- OPRM1 (3)
- PTGDR2 (3)
- PTGER1 (3)
- PTGER2 (3)
- QRFPR (3)
- S1PR2 (3)
- S1PR3 (3)
- S1PR4 (3)
- VIPR1 (3)
- ACKR3 (2)
- ACKR4 (2)
- ADGRF5 (2)
- ADORA3 (2)
- ADRA1A (2)
- ADRB3 (2)
- AVPR1A (2)
- BRS3 (2)
- CALCR (2)
- CALCRL (2)
- CCR7 (2)
- CCR8 (2)
- CHRM5 (2)
- CNR1 (2)
- CXCR5 (2)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (388)
- Calcium signaling pathway (119)
- Chemokine signaling pathway (38)
- Cytokine-cytokine receptor interaction (38)
- Gap junction (30)
- Melanogenesis (27)
- Endocytosis (25)
- Vascular smooth muscle contraction (25)
- Basal cell carcinoma (23)
- Colorectal cancer (23)
- Pathways in cancer (23)
- Wnt signaling pathway (23)
- Regulation of actin cytoskeleton (19)
- Long-term depression (12)
- Long-term potentiation (11)
- Renin-angiotensin system (11)
- Taste transduction (9)
- Axon guidance (7)
- Complement and coagulation cascades (7)
- Leukocyte transendothelial migration (7)
- Huntington's disease (4)
- Dilated cardiomyopathy (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- GnRH signaling pathway (3)
- Autoimmune thyroid disease (2)
- Parkinson's disease (2)
- Olfactory transduction (1)