Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Rabbit Polyclonal Anti-Presenilin 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1 |
Rabbit Polyclonal ADAM 17 (Thr735) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ADAM 17 around the phosphorylation site of Threonine 735 |
| Modifications | Phospho-specific |
Rabbit polyclonal ADAM 17 (Cleaved-Arg215) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ADAM 17. |
Rabbit Polyclonal Anti-PSEN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSEN2 antibody: synthetic peptide directed towards the N terminal of human PSEN2. Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV |
Rabbit Polyclonal Anti-PSEN1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY |
Rabbit Polyclonal Anti-Psen2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Psen2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Psen2. Synthetic peptide located within the following region: TAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYD |
Mouse Monoclonal Presenilin-2 Antibody (198C679.2.)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Presenilin-1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to the N terminal sequence MVELMFP and the C terminal sequence LLGLPID of the human Presenilin 1 protein. |
Rabbit polyclonal anti-ADAM17 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM17 |
Rabbit polyclonal anti-ADAM17 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM17 |
Rabbit anti Presenillin Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-ADAM17 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
