USD 380.00
In Stock
Rabbit Polyclonal Anti-CCL4 Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCL4 |
USD 380.00
In Stock
Rabbit Polyclonal Anti-CCL4 Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCL4 |
Rabbit Polyclonal Anti-CXCL3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CXCL3 |
Rabbit Polyclonal Anti-CXCL14 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CXCL14 |
Anti-Human BCA-1 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Rabbit Polyclonal Anti-CCL21 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCL21 |
Rabbit Polyclonal CCL2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal CCL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human CCL2. |
Rabbit polyclonal IL8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit polyclonal anti-CXCL1 (KC) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Anti-Human GRO-β Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human GRO-β (CXCL2) |
Anti-Human IP-10 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IP-10 (CXCL10) |
Rabbit Polyclonal Anti-GRO alpha
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha |
Anti-Human BRAK Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BRAK (CXCL14) |
Anti-Human GRO/MGSA Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human GRO/MGSA (CXCL1) |
Anti-Human MIG Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human MIG (CXCL9) |
Rabbit anti-CCL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL5 |
Rabbit anti-CXCL1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CXCL1 |
Rabbit Polyclonal Anti-Interleukin 8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8 |
Rabbit Polyclonal Anti-SDF 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
Rabbit polyclonal anti-Lymphotactin antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed mouse lymphotactin (a.a. 1-92) |
Rabbit polyclonal CCL2 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
Anti-Human IL-8 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-8 (72 a.a.) (CXCL8) |
Anti-Human I-TAC Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human I-TAC (CXCL11) |
USD 285.00
5 Days
Anti-Human MIP-3a Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human MIP-3α (CCL20) |
Anti-Human MIP-5 Goat Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human MIP-5 (CCL15) |
Rabbit anti-CCL28 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL28 |
Rabbit Polyclonal Anti-CXCL16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV |
Rabbit Polyclonal Anti-PF4V1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PF4V1 antibody: synthetic peptide directed towards the middle region of human PF4V1. Synthetic peptide located within the following region: RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE |
PF4 sheep polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | PF4 antibody was raised against platelet Factor 4 (PF4) purified from human platelet releasate. |
Rabbit Polyclonal antibody to PF4V1 (platelet factor 4 variant 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 40 and 104 of PF4V1 (Uniprot ID#P10720) |
Rabbit Polyclonal CCL4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4. |
Rabbit Polyclonal CCL17 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal CCL17 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CCL17. |
Rabbit Polyclonal CXCL12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCL12 antibody was raised against a 16 amino acid peptide near the center of human CXCL12 |
Biotinylated Anti-Human BCA-1 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Anti-Human CXCL16 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human CXCL16 |
Anti-Human ENA-78 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human ENA-78 (CXCL5) (5-78 a.a.) |
Anti-Human Exodus-2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Exodus-2 (CCL21) |
Anti-Human GRO-? Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human GRO-γ (CXCL3) |
Anti-Human MCP-1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human MCP-1 (CCL2) |
Anti-Human MEC Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human MEC (CCL28) |
Anti-Human NAP-2 Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human NAP-2 (CXCL7) |
Anti-Human PF-4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PF-4 (CXCL4) |
Anti-Human RANTES Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human RANTES (CCL5) |
Rabbit Polyclonal CXCL5 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal CXCL10/INP10 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-beta. |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-beta. |
Rabbit Polyclonal Eotaxin Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin. |
Rabbit polyclonal antibody to I-309 (chemokine (C-C motif) ligand 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 32 and 96 of I-309 (Uniprot ID#P22362) |