Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 380.00
In Stock
MCP-2 / CCL8 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Anti-Human BCA-1 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
PF4 mouse monoclonal antibody, clone KKO, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit polyclonal anti-CXCL1 (KC) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit Polyclonal Anti-GRO alpha
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha |
CCL5 / RANTES Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
Rabbit anti-CXCL1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXCL1 |
Rabbit Polyclonal Anti-Interleukin 8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8 |
Rabbit Polyclonal Anti-SDF 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
Rabbit polyclonal anti-Lymphotactin antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed mouse lymphotactin (a.a. 1-92) |
Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
USD 285.00
5 Days
Rabbit anti-CCL28 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL28 |
Rabbit Polyclonal Anti-CXCL16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV |
Rabbit Polyclonal Anti-PF4V1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PF4V1 antibody: synthetic peptide directed towards the middle region of human PF4V1. Synthetic peptide located within the following region: RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE |
IL8 (CXCL8) mouse monoclonal antibody, clone I8-61, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 257, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 807, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, Azide Free
| Applications | FC |
| Reactivities | Human |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C55, Azide Free
| Reactivities | Human |
PF4 sheep polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | PF4 antibody was raised against platelet Factor 4 (PF4) purified from human platelet releasate. |
Active filters
Families
- Secreted Protein
Pathways
- Chemokine signaling pathway
Filter by
Category
Target Symbol
- CCL2 (27)
- CXCL8 (26)
- CCL19 (17)
- CCL5 (16)
- CXCL12 (16)
- CCL3 (11)
- CCL11 (10)
- CXCL10 (9)
- CCL20 (8)
- CCL28 (8)
- CCL7 (8)
- CX3CL1 (7)
- PF4 (7)
- CXCL1 (6)
- CXCL14 (5)
- PPBP (5)
- CCL16 (4)
- CCL21 (4)
- CCL8 (4)
- CXCL13 (4)
- CXCL3 (4)
- CXCL5 (4)
- XCL1 (4)
- CCL1 (3)
- CCL14 (3)
- CCL17 (3)
- CCL23 (3)
- CCL26 (3)
- CCL4 (3)
- CXCL11 (3)
- CXCL16 (3)
- CXCL2 (3)
- CXCL6 (3)
- CCL13 (2)
- CCL15 (2)
- CCL25 (2)
- CCL3L1 (2)
- CXCL9 (2)
- PF4V1 (2)
- CCL18 (1)
- CCL24 (1)