TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700026 |
TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700026 |
Rabbit Polyclonal Anti-GNAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
Applications | ELISA, FN, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-GNAS Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNAS |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2) |
Anti-Human IGF-I Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit polyclonal anti-TGF Beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β1 antibody. |
Rabbit Polyclonal TGFβ3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3. |
Rabbit anti-IGF1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human IGF1 |
Rabbit polyclonal anti-TGF beta2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Rabbit polyclonal anti-TGF beta3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
GNAS Rabbit Polyclonal (aa385-394) Antibody
Applications | IHC |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Rabbit Polyclonal Anti-GNAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the C terminal of human GNAS. Synthetic peptide located within the following region: YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY |
Rabbit Polyclonal Anti-TGF beta1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit Polyclonal Anti-IGF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1 |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
Applications | E |
Reactivities | Human, Monkey |
Conjugation | Biotin |
Rabbit anti-TGFB1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | peptide coupled to KLH |
Goat Anti-IGF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1. |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal TNFA Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit anti IGF-I Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2) |
Rabbit polyclonal anti-TGF-beta2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 366 of human TGF-β2 |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal anti-GNAS antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Rabbit Polyclonal Anti-DAG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DAG1 antibody: synthetic peptide directed towards the middle region of human DAG1. Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
G protein alpha S (GNAS) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GNAS |
Goat Anti-GNAS Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QAARSNSDGEKATK, from the internal region of the protein sequence according to NP_000507.1; NP_001070956.1; NP_001070957.1. |
Goat Anti-DAG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVGKHEYFMHATDK, from the internal region of the protein sequence according to NP_004384.3. |
Rabbit polyclonal anti-IGF-I antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed human IGF-I |
Rabbit polyclonal anti-TGF-beta2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human TGF-β2 |
Rabbit polyclonal TGF beta 1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TGF beta 1 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of the mature growth factor (112 amino acids in length). |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Biotinylated Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Biotinylated Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal anti-GNAS antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD |
Mouse Monoclonal Anti-TNF-alpha Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti TGF-beta 2 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein. |
Rabbit anti TGF beta Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human TGF-beta protein. |