EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-Insulin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin |
Rabbit anti-FGFR2 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human FGFR2 |
IGF1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1) |
Anti-Human IGF-I Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IGF-I |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
IGF1 mouse monoclonal antibody, clone M23/ILG1-001, Purified
Applications | ELISA, R |
Reactivities | Human |
Mouse monoclonal Insulin antibody
Applications | Dot, ELISA |
Conjugation | Unconjugated |
Rabbit anti-IGF1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human IGF1 |
Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
FGFR2 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3B3
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700364 |
FGFR2 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5F7
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700365 |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
Applications | ELISA, IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
USD 440.00
2 Weeks
Prostate Specific Antigen (KLK3) (26-251) mouse monoclonal antibody, clone 5A11E2, Ascites
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
IGF1 mouse monoclonal antibody, clone AT6F8, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
EGFR sheep polyclonal antibody, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Immunogen | Synthetic 20 amino acid peptide of human EGFr representing a portion of the internal domain proximal to a phosphorylation region |
USD 380.00
2 Weeks
Prostate Specific Antigen (KLK3) mouse monoclonal antibody, clone LT-3D2, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
IGF1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1) |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
Modifications | Phospho-specific |
Rabbit polyclonal FGFR2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human FGFR2. |
Rabbit Polyclonal Anti-FGFR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGFR2 Antibody: A synthesized peptide derived from human FGFR2 |
Rabbit Polyclonal Anti-KLK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLK3 Antibody: A synthesized peptide derived from human KLK3 |
Rabbit Polyclonal Anti-TGF alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGF alpha Antibody: A synthesized peptide derived from human TGF alpha |
Rabbit Polyclonal Anti-EGFR Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-IGF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1 |
FGFR2 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2D1
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700364 |
FGFR2 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1H5
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700367 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1B10
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI2E1
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700471 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3D7
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3F2
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700472 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI11H7
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700473 |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-ERBB1 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
Goat Polyclonal Anti-INS Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
USD 530.00
2 Weeks
EGFR pTyr1069 (incl. pos. control) mouse monoclonal antibody, clone 11C2, Biotin
Applications | ELISA, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
EGFR pTyr1016 mouse monoclonal antibody, clone EM-12, Purified
Applications | FC, IP, WB |
Reactivities | Human |
EGFR pTyr1197 mouse monoclonal antibody, clone EM-13, Purified
Applications | FC, IP, WB |
Reactivities | Human |
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
FGFR2 (621-724) mouse monoclonal antibody, clone 1G3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
EGFR mouse monoclonal antibody, clone AT2H8, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
EGFR mouse monoclonal antibody, clone AT2H8, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
IGF1 mouse monoclonal antibody, clone AT6F8, Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 5E4/3 (D6C4), Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
USD 250.00
2 Weeks
Prostate Specific Antigen (KLK3) mouse monoclonal antibody, clone A67-B/E3, Biotin
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |