Antibodies

View as table Download

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1.

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific

Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1

Applications ELISA, FC, IF, IHC, IP, WB
Reactivities Human, Rat

Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125
Modifications Phospho-specific

Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353)

Rabbit Polyclonal Coxsackie Adenovirus Receptor Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Caspase 9 (CASP9) (299-318) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Akirin1 antibody was raised against peptide corresponding to aa 299-318 of the human Caspase 9.

Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R).
Modifications Phospho-specific

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal CASP9 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9.

Rabbit anti-CXADR Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CXADR

Cyclin D1 (CCND1) mouse monoclonal antibody, clone CY-D1, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human

Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human

Cyclin D1 (CCND1) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen CCND1 antibody was raised against kLH conjugated synthetic peptide corresponding to amino acid residues surrounding S90 of human Cyclin D1.

Rabbit polyclonal anti-CXADR antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CXADR.

Rabbit Polyclonal Caspase 9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286.

Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90
Modifications Phospho-specific

Rabbit anti-CASP9 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP9

Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Caspase-9 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-9 antibody was raised against a peptide corresponding to amino acids 299 to 318 of human caspase-9 .

Rabbit polyclonal antibody to Caspase-9 (caspase 9, apoptosis-related cysteine peptidase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 88 and 416 of Caspase 9 (Uniprot ID#P55211)

Rabbit polyclonal Phospho-Caspase 9(S196) Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Phospho-Caspase 9-S196 antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S196 of human caspase 9.
Modifications Phospho-specific

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).

Rabbit anti Caspase 9 Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide derived from N-terminus of human Caspase 9 protein

Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 345 of Mouse Caspase-9

Cyclin D1 (CCND1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CCND1

Cyclin D1 (CCND1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human Cyclin D1

Caspase 9 (CASP9) (301-305) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.301~305 derived from Caspase 9

Caspase 9 (CASP9) (301-305) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.301~305 derived from Caspase 9

Rabbit Polyclonal Caspase-9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Caspase-9 antibody was raised against a peptide corresponding to amino acids 41 to 56 of human caspase-9 .

Rabbit polyclonal Cyclin D1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Cyclin D1 was produced by repeated immunizations of full length fusion protein corresponding to the human gene sequence.

Rabbit polyclonal CCND1 Antibody (C-term T288)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CCND1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 267-294 amino acids from the C-terminal region of human CCND1.

Goat Anti-cyclin D1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TRFLSRVIKCDPD, from the internal region of the protein sequence according to NP_444284.1

Rabbit Polyclonal Anti-CXADR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK

Rabbit Polyclonal Anti-CXADR Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Zebra finch, Platypus, Lizard (93%); Xenopus, Stickleback, Pufferfish, Zebrafish (80%).

Rabbit Polyclonal Anti-CXADR Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Galago, Horse (93%); Marmoset, Mouse, Elephant, Panda, Bat, Bovine, Rabbit, Pig, Guinea pig (87%); Rat, Hamster (80%).

Mouse Monoclonal Caspase-9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Caspase-9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti Cyclin D1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat.

Carrier-free (BSA/glycerol-free) CCND1 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CCND1 mouse monoclonal antibody,clone OTI8B2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) CCND1 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated