Germany
Japan
United Kingdom
China
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Antibodies
View as table Download
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal Anti-WNT8B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the N terminal of human WNT8B. Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG |
c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
| Applications | IF, IP, WB |
| Reactivities | Mammalian |
c-Myc (MYC) chicken polyclonal antibody, FITC
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared. |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Mouse Monoclonal anti-c-Myc Antibody
| Applications | WB |
| Reactivities | Human and fusion proteins in All Species |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR |
Rabbit Polyclonal Anti-MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CY-D1, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
| Applications | IF, IP, WB |
| Reactivities | Mammalian |
FGF4 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98 %) recombinant human FGF-4 |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Conjugation | Biotin |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) rabbit polyclonal antibody, HRP
| Applications | ELISA, IHC, WB |
| Conjugation | HRP |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, FITC
| Applications | FC, IF, IHC |
| Reactivities | Human |
| Conjugation | FITC |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit Polyclonal Cyclin D1 Antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286. |
Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58 |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Stem cell relevant signaling - Wnt Signaling pathway
Pathways
- Pathways in cancer
Filter by
Target Symbol
Reactivities
- Human (135)
- Mouse (109)
- Rat (88)
- Bovine (10)
- Dog (10)
- Monkey (6)
- Chicken (5)
- Bat (4)
- Pig (4)
- Gibbon (3)
- Gorilla (3)
- Horse (3)
- Rabbit (3)
- Hamster (2)
- Sheep (2)
- Xenopus (2)
- Zebrafish (2)
- Chimpanzee (1)
- Cow (1)
- Drosophila (1)
- Feline (1)
- Guinea Pig (1)
- Macaque (1)
- Opossum (1)
- Primate (1)
- Rhesus Monkey (1)
- Yeast (1)