Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CCR4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL |
Rabbit Polyclonal Anti-CXCR3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR3 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Goat, Panda (82%). |
Rabbit Polyclonal Anti-CXCL16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV |
Rabbit Polyclonal Anti-IL8RB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
Rabbit Polyclonal Anti-CCR7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7 |
Rabbit Polyclonal Anti-CCR7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7 |
Rabbit Polyclonal Anti-Phospho-CCR5(Ser349) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-CCR5(Ser349) Antibody: A synthesized peptide derived from human CCR5 around the phosphorylation site of Sersine 349 |
| Modifications | Phospho-specific |
IL8 (CXCL8) mouse monoclonal antibody, clone I8-61, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 257, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL8 (CXCL8) mouse monoclonal antibody, clone 807, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, Azide Free
| Applications | FC |
| Reactivities | Human |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C55, Azide Free
| Reactivities | Human |
PF4 sheep polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | PF4 antibody was raised against platelet Factor 4 (PF4) purified from human platelet releasate. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit polyclonal CCR5 (Ser349) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 349 (E-I-SP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ADCY5/ADCY6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306). |
CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%). |
Mouse Anti-Human CD182 (CXCR2) Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal CCR5 (Ser336) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 around the phosphorylation site of Serine 336 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CCR5 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 |
Rabbit Polyclonal CXCL10/INP10 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
IL8 (CXCL8) mouse monoclonal antibody, clone B-K8, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
PF4 mouse monoclonal antibody, clone RTO, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
PF4 mouse monoclonal antibody, clone RTO, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
PF4 mouse monoclonal antibody, clone KKO, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
CCR7 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 280-330 of Human CCR7. |
Active filters
Families
- Transmembrane
Pathways
- Chemokine signaling pathway
Filter by
Category
Target Symbol
- CXCL8 (26)
- CXCR4 (23)
- CCL5 (16)
- CCR5 (11)
- CCR7 (11)
- CCL11 (10)
- CX3CR1 (10)
- CXCL10 (9)
- CXCR2 (9)
- CXCR3 (9)
- CCR8 (8)
- CCR3 (7)
- CCR4 (7)
- CX3CL1 (7)
- PF4 (7)
- CCR1 (5)
- CXCL14 (5)
- CXCR1 (5)
- CXCR6 (5)
- PPBP (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- CCR6 (4)
- ADCY2 (3)
- ADCY6 (3)
- CCL4 (3)
- CCR2 (3)
- CXCL11 (3)
- CXCL16 (3)
- CXCR5 (3)
- ADCY3 (2)
- ADCY8 (2)
- CCL15 (2)
- CCR10 (2)
- CCR9 (2)
- CXCL9 (2)
- XCR1 (2)
- ADCY7 (1)
- ADCY9 (1)
- CCL24 (1)
- CCL4L1 (1)