Antibodies

View as table Download

Mouse Monoclonal anti-KDELR1 Antibody

Applications IF, WB
Reactivities Human, Monkey, Rat, Mouse, Hamster, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Drosophilia, Xenopus
Conjugation Unconjugated

Rabbit Polyclonal AGPAT6 Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human AGPAT6 protein sequence (between residues 400-456). [Swiss-Prot Q86UL3]

Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control

Applications FC, IHC, WB
Reactivities Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus
Conjugation Unconjugated

Rabbit Polyclonal Niemann-Pick C1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Porcine, Hamster, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118]

Rabbit Polyclonal DUOX2 Antibody

Applications WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8]

Rabbit Polyclonal Aquaporin-2 Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Porcine, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080]

Rabbit Polyclonal MUC-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))

Applications WB
Reactivities Bovine, Canine, Human, Porcine, Rabbit, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Mouse Monoclonal anti-RHO Antibody

Applications IF
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Rabbit Polyclonal Lgr5/GPR49 Antibody

Applications IHC
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human GPR49/LGR5 protein (within residues 650-700). [Swiss-Prot# O75473]

Rabbit Polyclonal TLR5 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5.

Rabbit Polyclonal anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal SLC31A1/CTR1 Antibody

Applications IHC
Reactivities Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen A synthetic peptide derived from a C-terminal sequence of the human CTR1.

Mouse Anti-Synaptobrevin (VAMP) Antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated

Mouse Anti-Syntaxin Antibody

Applications WB
Reactivities Hamster, Human, Porcine, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-CANX Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Mouse Monoclonal Bestrophin 1 Antibody (E6-6)

Applications WB
Reactivities Human, Porcine, Primate
Conjugation Unconjugated

Rabbit Polyclonal Kv1.2 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142]

Rabbit Polyclonal Kv1.2 Antibody

Applications IF
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142]

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine, Feline, Hamster, Porcin
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817]

Rabbit Polyclonal Kv1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu
Conjugation Unconjugated
Immunogen Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family.

Rabbit Polyclonal Gastrokine 1 Antibody

Applications WB
Reactivities Human, Equine, Porcine, Primate
Conjugation Unconjugated
Immunogen The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen.