Mouse Monoclonal anti-KDELR1 Antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Rat, Mouse, Hamster, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Drosophilia, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal anti-KDELR1 Antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Rat, Mouse, Hamster, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Drosophilia, Xenopus |
Conjugation | Unconjugated |
Rabbit Polyclonal AGPAT6 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Porcine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human AGPAT6 protein sequence (between residues 400-456). [Swiss-Prot Q86UL3] |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
Applications | FC, IHC, WB |
Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
Conjugation | Unconjugated |
Rabbit Polyclonal Niemann-Pick C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Rabbit Polyclonal DUOX2 Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8] |
Rabbit Polyclonal Aquaporin-2 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminus portion of the rat protein (within residues 200-300). [Swiss-Prot# P34080] |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
USD 424.00
In Stock
Mouse Monoclonal Sodium Potassium ATPase Beta 1 Antibody (464.8 (also known as 8A))
Applications | WB |
Reactivities | Bovine, Canine, Human, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Mouse Monoclonal anti-RHO Antibody
Applications | IF |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Lgr5/GPR49 Antibody
Applications | IHC |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human GPR49/LGR5 protein (within residues 650-700). [Swiss-Prot# O75473] |
Rabbit Polyclonal TLR5 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Rabbit Polyclonal anti-CANX Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
Conjugation | Unconjugated |
Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal SLC31A1/CTR1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CTR1. |
Mouse Anti-Synaptobrevin (VAMP) Antibody
Applications | WB |
Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Mouse Anti-Syntaxin Antibody
Applications | WB |
Reactivities | Hamster, Human, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
Conjugation | Unconjugated |
Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Mouse Monoclonal Bestrophin 1 Antibody (E6-6)
Applications | WB |
Reactivities | Human, Porcine, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Kv1.2 Antibody
Applications | WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142] |
Rabbit Polyclonal Kv1.2 Antibody
Applications | IF |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142] |
Rabbit Polyclonal Bcl-xL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Kv1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family. |
Rabbit Polyclonal Gastrokine 1 Antibody
Applications | WB |
Reactivities | Human, Equine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen. |