Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACTB |
Rabbit Polyclonal Anti-ITGB3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB3 |
Rabbit Polyclonal Anti-LMNA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LMNA |
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ITGB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB1 |
Goat Polyclonal Anti-beta-Actin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. |
Rabbit Polyclonal anti-Phospho-PLB(T17) Antibody
Applications | Dot |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The PLB Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T17 of human PLB. |
Rabbit Polyclonal Anti-ITGB5 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB5 |
Rabbit Polyclonal Beta-actin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | b-actin antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human b-actin. |
LMNA Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LMNA |
Rabbit anti-EMD Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EMD |
Goat Anti-CACNA1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit Polyclonal Anti-TPM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
Rabbit polyclonal anti-SGCA antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SGCA. |
Rabbit Polyclonal Anti-DES Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the middle region of human DES. Synthetic peptide located within the following region: MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT |
Rabbit Polyclonal Anti-GNAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit Polyclonal antibody to beta Actin (actin, beta)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
TPM3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TPM3 |
Rabbit anti-PRKACB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKACB |
Rabbit Monoclonal Antibody against Beta-Actin
Applications | IHC, WB |
Reactivities | All Species |
Conjugation | Unconjugated |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
Applications | IHC |
Reactivities | Human |
Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
TPM1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TPM1 |
Rabbit anti-TNNC1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNNC1 |
Rabbit Polyclonal Anti-TPM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM2 antibody: synthetic peptide directed towards the C terminal of human TPM2. Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL |
Rabbit monoclonal antibody against Actin (Pan)(EP184E)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Cow |
Conjugation | Unconjugated |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit polyclonal anti-MYBPC3 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MYBPC3. |
Rabbit anti-GNAS Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNAS |
Rabbit Polyclonal Anti-ADCY6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Goat Polyclonal Anti-cardiac troponin T Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Feline, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-cardiac troponin T Antibody: Peptide with sequence C-RNRINDNQKVSKT, from the C Terminus of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Goat Anti-Desmin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RDGEVVSEATQQQHE, from the C Terminus of the protein sequence according to NP_001918.3. |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2) |
ITGAV Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ITGAV |
Anti-Human IGF-I Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACTB |
Rabbit polyclonal anti-TGF Beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β1 antibody. |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
Modifications | Phospho-specific |
Rabbit Polyclonal TGFβ3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3. |
Rabbit anti-IGF1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human IGF1 |
Rabbit Polyclonal Anti-TPM1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
Rabbit Polyclonal Anti-DES Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the N terminal of human DES. Synthetic peptide located within the following region: PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit Polyclonal Anti-ACTIN Antibody
Applications | WB |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of Arabidopsis thaliana actin |