Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Goat Polyclonal Anti-PCNA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Rabbit Polyclonal Anti-MSH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG |
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit anti-MLH1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MLH1 |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
MSH2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MSH2 |
Rabbit anti-MSH3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MSH3 |
Rabbit Polyclonal Anti-MLH3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLH3 antibody: synthetic peptide directed towards the middle region of human MLH3. Synthetic peptide located within the following region: SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP |
Rabbit monoclonal antibody against MLH1(clone EPR3893)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal Anti-MSH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV |
Rabbit Polyclonal Anti-POLD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Rabbit Polyclonal Anti-PCNA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Rabbit polyclonal anti-MLH1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MLH1. |
Rabbit polyclonal RFA2 (Ab-21) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Rabbit polyclonal anti-RFC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RFC2. |
Rabbit polyclonal anti-MSH6 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MSH6. |
Rabbit polyclonal anti-MLH3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MLH3. |
Rabbit polyclonal MSH2 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MSH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 637-665 amino acids from the Central region of human MSH2. |
Rabbit Polyclonal RFA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 |
Rabbit Polyclonal RFA2 (Thr21) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human RFA2 around the phosphorylation site of Threonine 21 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RFC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RFC2 |
PMS2 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340) |
Rabbit polyclonal anti-POLD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
| Modifications | Phospho-specific |
Anti-RPA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human replication protein A1, 70kDa |
Rabbit polyclonal Anti-MLH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLH1 antibody: synthetic peptide directed towards the N terminal of human MLH1. Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK |
Rabbit Polyclonal Anti-RFC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE |
Active filters
Isotypes
- IgG
Pathways
- Mismatch repair