Rabbit Polyclonal Anti-OR10J5 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR10J5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human OR10J5. Percent identity with other species by BLAST analysis: Human, Gibbon, Elephant, Horse (100%); Gorilla, Hamster, Dog (94%); Mouse, Rat, Panda (88%); Bovine, Pig (81%). |
Rabbit polyclonal Anti-PDE1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE1C antibody: synthetic peptide directed towards the middle region of human PDE1C. Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR |
Rabbit polyclonal Anti-PRKX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD |
Rabbit Polyclonal Anti-OR1C1 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1C1 antibody: synthetic peptide directed towards the C terminal of human OR1C1. Synthetic peptide located within the following region: AVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVL |
Rabbit Polyclonal Anti-OR1D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1D2 antibody: synthetic peptide directed towards the C terminal of human OR1D2. Synthetic peptide located within the following region: LHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT |
Rabbit Polyclonal Anti-OR1G1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1G1 antibody: synthetic peptide directed towards the C terminal of human OR1G1. Synthetic peptide located within the following region: FSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSSLRKLIWVRK |
Rabbit Polyclonal Anti-OR1I1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1I1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR1I1. Synthetic peptide located within the following region: GKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME |
Rabbit Polyclonal Anti-OR1J1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1J1 antibody: synthetic peptide directed towards the C terminal of human OR1J1. Synthetic peptide located within the following region: TKGICKALSTCGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTA |
Rabbit Polyclonal Anti-OR1L8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1L8 antibody: synthetic peptide directed towards the C terminal of human OR1L8. Synthetic peptide located within the following region: MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT |
Rabbit Polyclonal Anti-OR1S1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1S1 antibody: synthetic peptide directed towards the C terminal of human OR1S1. Synthetic peptide located within the following region: FSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP |
Rabbit Polyclonal Anti-OR1S1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR1S1 antibody: synthetic peptide directed towards the C terminal of human OR1S1. Synthetic peptide located within the following region: FPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKIS |
Rabbit Polyclonal Anti-OR2A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2A5 antibody: synthetic peptide directed towards the C terminal of human OR2A5. Synthetic peptide located within the following region: ILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQ |
Rabbit Polyclonal Anti-OR2B2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2B2 antibody: synthetic peptide directed towards the C terminal of human OR2B2. Synthetic peptide located within the following region: IAPMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTY |
Rabbit Polyclonal Anti-OR2C1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2C1 antibody: synthetic peptide directed towards the C terminal of human OR2C1. Synthetic peptide located within the following region: FYGSASYGYLLPAKNSKQDQGKFISLFYSLVTPMVNPLIYTLRNMEVKGA |
Rabbit Polyclonal Anti-OR2C3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2C3 antibody: synthetic peptide directed towards the C terminal of human OR2C3. Synthetic peptide located within the following region: LFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKS |
Rabbit Polyclonal Anti-OR2D3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2D3 antibody: synthetic peptide directed towards the C terminal of human OR2D3. Synthetic peptide located within the following region: LKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPM |
Rabbit Polyclonal Anti-OR2H1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2H1 antibody: synthetic peptide directed towards the C terminal of human OR2H1. Synthetic peptide located within the following region: IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL |
Rabbit Polyclonal Anti-OR2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2H2 antibody: synthetic peptide directed towards the C terminal of human OR2H2. Synthetic peptide located within the following region: SLILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQ |
Rabbit Polyclonal Anti-OR2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2H2 antibody: synthetic peptide directed towards the C terminal of human OR2H2. Synthetic peptide located within the following region: FCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVS |
Rabbit Polyclonal Anti-OR2J2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2J2 antibody: synthetic peptide directed towards the C terminal of human OR2J2. Synthetic peptide located within the following region: STTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT |
Rabbit Polyclonal Anti-OR2J2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2J2 antibody: synthetic peptide directed towards the C terminal of human OR2J2. Synthetic peptide located within the following region: VMCMYLQPPSENSPDQGKFIALFYTVVTPSLNPLIYTLRNKHVKGAAKRL |
Rabbit Polyclonal Anti-OR2K2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2K2 antibody: synthetic peptide directed towards the C terminal of human OR2K2. Synthetic peptide located within the following region: TCGAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPII |
Rabbit Polyclonal Anti-OR2L3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2L3 antibody: synthetic peptide directed towards the C terminal of human OR2L3. Synthetic peptide located within the following region: KSAEGRKKAYLTCSTHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFY |
Rabbit Polyclonal Anti-OR2M2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2M2 antibody: synthetic peptide directed towards the C terminal of human OR2M2. Synthetic peptide located within the following region: KEVTRAFMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIM |
Rabbit Polyclonal Anti-OR2T1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2T1 antibody: synthetic peptide directed towards the C terminal of human OR2T1. Synthetic peptide located within the following region: KPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGALKRALGRFKGPQRVSG |
Rabbit Polyclonal Anti-GUCA1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GUCA1B antibody: synthetic peptide directed towards the N terminal of human GUCA1B. Synthetic peptide located within the following region: SGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN |
Rabbit Polyclonal Anti-OR2W1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2W1 antibody: synthetic peptide directed towards the C terminal of human OR2W1. Synthetic peptide located within the following region: VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD |
Rabbit Polyclonal Anti-OR2T29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR2T29 antibody: synthetic peptide directed towards the C terminal of human OR2T29. Synthetic peptide located within the following region: GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK |
Rabbit Polyclonal Anti-CAMK2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAMK2B antibody: synthetic peptide directed towards the C terminal of human CAMK2B. Synthetic peptide located within the following region: NPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNV |
Rabbit anti CamKII(pT286) Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRKG2 mouse monoclonal antibody,clone OTI10D5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRKG2 mouse monoclonal antibody,clone OTI15E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAMK2B mouse monoclonal antibody, clone OTI10G2 (formerly 10G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAMK2B mouse monoclonal antibody,clone OTI4G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAMK2B mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI1C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI2F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI6A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAL mouse monoclonal antibody,clone OTI4F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-CLCA4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 306-476 amino acids of Human Calcium-activated chloride channel regulator 4 |
Anti-PRKACG Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma |
Anti-CAMK2B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 14-272 amino acids of human Calcium/calmodulin-dependent protein kinase type II subunit beta |
Anti-CNGA3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 482-605 amino acids of human cyclic nucleotide gated channel alpha 3 |
Germany
Japan
United Kingdom
China
