Antibodies

View as table Download

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the middle region of human ITPK1. Synthetic peptide located within the following region: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI

Rabbit Polyclonal Anti-PSTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSTK antibody: synthetic peptide directed towards the middle region of human PSTK. Synthetic peptide located within the following region: SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

Rabbit Polyclonal Anti-EPRS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPRS antibody: synthetic peptide directed towards the middle region of human EPRS. Synthetic peptide located within the following region: KSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKK

Rabbit Polyclonal Anti-EPRS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPRS antibody: synthetic peptide directed towards the middle region of human EPRS. Synthetic peptide located within the following region: GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Rabbit Polyclonal Anti-EARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EARS2 antibody: synthetic peptide directed towards the middle region of human EARS2. Synthetic peptide located within the following region: TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL

Rabbit Polyclonal Anti-WARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WARS2 antibody: synthetic peptide directed towards the middle region of human WARS2. Synthetic peptide located within the following region: TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

Rabbit Polyclonal Anti-VARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP

Rabbit Polyclonal Anti-HARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HARS antibody: synthetic peptide directed towards the N terminal of human HARS. Synthetic peptide located within the following region: FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL

Rabbit Polyclonal Anti-TARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human TARS2. Synthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI2A2 (formerly 2A2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HARS2 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HARS2 mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HARS2 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)

Applications FC, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HARS2 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HARS2 mouse monoclonal antibody, clone OTI6F9 (formerly 6F9)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GARS mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GARS mouse monoclonal antibody, clone OTI6C5 (formerly 6C5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GARS mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NARS2 mouse monoclonal antibody, clone OTI10C10 (formerly 10C10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NARS2 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NARS2 mouse monoclonal antibody, clone OTI10E2 (formerly 10E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NARS2 mouse monoclonal antibody,clone OTI8D10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NARS2 mouse monoclonal antibody,clone OTI5A9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NARS2 mouse monoclonal antibody, clone OTI10H7 (formerly 10H7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FARSB mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EARS2 mouse monoclonal antibody,clone OTI2B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EARS2 mouse monoclonal antibody,clone OTI2C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KARS mouse monoclonal antibody,clone OTI1E7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-AARS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to N terminal 14 amino acids of human alanyl-tRNA synthetase

Anti-AARS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to N terminal 14 amino acids of human alanyl-tRNA synthetase

Anti-AARS2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 686-985 amino acids of human alanyl-tRNA synthetase 2, mitochondrial

Anti-AARS2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 686-985 amino acids of human alanyl-tRNA synthetase 2, mitochondrial

Rabbit Polyclonal Anti-FARSB Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FARSB

Rabbit Polyclonal Anti-YARS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human YARS2

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KARS

FARS2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FARS2

NARS Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

SARS2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

IARS2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

RARS Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

MTFMT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human
Conjugation Unconjugated

MTFMT mouse monoclonal antibody, clone OTI1B10 (formerly 1B10), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin