Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit monoclonal antibody against Rb (clone EP44(2) )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-BUB1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BUB1 |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
YWHAQ Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human YWHAQ |
Rabbit anti-TTK Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TTK |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CCNB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3. Synthetic peptide located within the following region: ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE |
Rabbit Polyclonal Anti-ABL1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABL1 |
Rabbit Polyclonal Anti-RB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RB1 |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal 14-3-3 zeta/delta (Ab-232) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human 14-3-3 ?/d around the phosphorylation site of threonine 232 (S-D-TP-Q-G) |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal Cyclin B1 (Ab-126) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S). |
Rabbit polyclonal Cyclin H (Ab-315) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D). |
Rabbit polyclonal Cyclin D3 (Thr283) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin D3 around the phosphorylation site of threonine 283 (T-S-TP-P-T). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Human
Pathways
- Cell cycle
Filter by
Target Symbol
- TP53 (238)
- CDKN2A (197)
- GADD45G (133)
- PCNA (119)
- MDM2 (118)
- CDK2 (63)
- BUB1B (59)
- MCM2 (58)
- RB1 (56)
- CHEK2 (53)
- CDKN2C (51)
- PLK1 (49)
- SMC1A (44)
- HDAC1 (41)
- MYC (41)
- CCND2 (40)
- CDKN1A (36)
- CDKN2B (35)
- ANAPC11 (33)
- ANAPC2 (31)
- CCND1 (30)
- CDC6 (27)
- SMAD2 (27)
- ZBTB17 (25)
- HDAC2 (24)
- CHEK1 (21)
- SMAD3 (20)
- CDC25A (19)
- TGFB1 (19)
- CDC25B (18)
- PKMYT1 (18)
- CCNB1 (17)
- CDK1 (17)
- E2F5 (17)
- GSK3B (17)
- RAD21 (17)
- E2F4 (16)
- GADD45A (14)
- MAD2L1 (14)
- TTK (14)
- YWHAZ (14)
- ABL1 (13)
- TFDP2 (13)
- CCNE1 (12)
- CDC45 (12)
- MCM5 (12)
- RBL1 (12)
- PRKDC (11)
- E2F1 (10)
- CCNA1 (9)
- CDC25C (9)
- CDK7 (9)
- CDKN1B (9)
- YWHAB (9)
- MCM7 (8)
- SMAD4 (8)
- TFDP1 (8)
- TGFB2 (8)
- ANAPC1 (7)
- ATM (7)
- CCNA2 (7)
- CCND3 (7)
- CCNH (7)
- CDC16 (7)
- CDKN1C (7)
- E2F2 (7)
- EP300 (7)
- MCM3 (7)
- SFN (7)
- YWHAE (7)
- BUB1 (6)
- CDC2 (6)
- CDC23 (6)
- CDC27 (6)
- CDK4 (6)
- CDK6 (6)
- YWHAG (6)
- YWHAQ (6)
- ANAPC10 (5)
- CCNB2 (5)
- CCNE2 (5)
- CDC20 (5)
- CREBBP (5)
- CUL1 (5)
- MCM6 (5)
- RBL2 (5)
- ANAPC5 (4)
- ATR (4)
- BUB3 (4)
- CDC7 (4)
- DCLRE1C (4)
- ESPL1 (4)
- MCM4 (4)
- ORC3 (4)
- PTTG1 (4)
- TGFB3 (4)
- ANAPC13 (3)
- ANAPC4 (3)
- CCNB3 (3)
- CDC26 (3)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2099)
- Transcription Factors (867)
- Stem cell - Pluripotency (839)
- Protein Kinase (385)
- Stem cell relevant signaling - JAK/STAT signaling pathway (118)
- Embryonic stem cells (88)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (88)
- Stem cell relevant signaling - DSL/Notch pathway (83)
- Stem cell relevant signaling - Wnt Signaling pathway (71)
- ES Cell Differentiation/IPS (66)
- Phosphatase (48)
- Cancer stem cells (47)
- Adult stem cells (41)
- Induced pluripotent stem cells (41)
- Secreted Protein (38)
- Transmembrane (12)
- Protease (4)