USD 379.00
2 Weeks
CYP1A2 Capture mouse monoclonal antibody, ELISA validated, clone OTI7A9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700038 |
USD 379.00
2 Weeks
CYP1A2 Capture mouse monoclonal antibody, ELISA validated, clone OTI7A9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700038 |
Aldehyde Oxidase (AOX1) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human AOX1 |
FMO3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human FMO3 |
UGT2B17 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human UDB17 |
ADH5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ADH5 |
ALDH3B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ALDH3B |
CYP2A13 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2A13 |
CYP2C18 (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human CYP2C18 |
Cytochrome P450 3A5 (CYP3A5) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CYP3A5 |
Glutathione S Transferase alpha 1 (GSTA1) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | GSTA1 recombinant protein |
USD 407.00
2 Weeks
Glutathione S Transferase theta 1 (GSTT1) (+GSTT4) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 407.00
2 Weeks
Microsomal Glutathione S transferase 1 (MGST1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GSTA3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GSTA3. |
Goat Polyclonal Antibody against GST3 / GSTP1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LADQGQSWKEEV, from the internal region of the protein sequence according to NP_000843.1. |
Goat Polyclonal Antibody against MAOB
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Goat Polyclonal Antibody against Monoamine Oxidase A
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1. |
Goat Polyclonal Antibody against ADH1A, B, C
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
Goat Polyclonal Antibody against GSTM1 / GSTM2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CVFSKMAVWGNK, from the C Terminus of the protein sequence according to NP_000552; NP_666533; NP_000839. |
Goat Anti-ADH5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Rabbit Polyclonal Aldh3A1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1. |
Rabbit polyclonal antibody to ALDH3B2 (aldehyde dehydrogenase 3 family, member B2)
Reactivities | Human |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 135 and 341 of Human ALDH3B2 |
Rabbit Polyclonal antibody to UGT2B7 (UDP glucuronosyltransferase 2 family, polypeptide B7)
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 278 of UGT2B7 (Uniprot ID#P16662) |
Goat Anti-ALDH3B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QDLHKSAFESEVSE, from the internal region of the protein sequence according to NP_000685.1. |
Rabbit polyclonal anti-ADH7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADH7. |
Rabbit polyclonal anti-CYP2D6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP2D6. |
Rabbit polyclonal Cytochrome P450 3A43 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43. |
Anti-GSTT1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-GSTM2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
GSTO1 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Internal region (near C terminus) (KEDPTVSALLTSEKD) |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
Rabbit polyclonal Anti-GSTZ1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTZ1 antibody: synthetic peptide directed towards the N terminal of human GSTZ1. Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF |
Rabbit polyclonal Anti-GSTA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5. Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE |
Rabbit polyclonal Anti-GSTO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTO2 antibody: synthetic peptide directed towards the N terminal of human GSTO2. Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV |
Rabbit polyclonal Anti-UGT1A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM |
Rabbit Polyclonal Anti-GSTK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the N terminal of human GSTK1. Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK |
Rabbit Polyclonal Anti-GSTK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSTK1 Antibody: synthetic peptide directed towards the middle region of human GSTK1. Synthetic peptide located within the following region: NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL |
Rabbit polyclonal Anti-MAOA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA |
Rabbit polyclonal Anti-MAOA Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE |
Rabbit Polyclonal Anti-FMO3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG |
Rabbit Polyclonal Anti-FMO3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE |
Rabbit Polyclonal Anti-Fmo3 Antibody
Applications | WB |
Reactivities | Mouse |
Immunogen | The immunogen for anti-Fmo3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE |
Rabbit Polyclonal Anti-GSTM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSTM3 Antibody: synthetic peptide directed towards the middle region of human GSTM3. Synthetic peptide located within the following region: SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF |
Rabbit Polyclonal Anti-ALDH3B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALDH3B1 Antibody: synthetic peptide directed towards the N terminal of human ALDH3B1. Synthetic peptide located within the following region: DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
Rabbit Polyclonal Anti-CYP3A4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG |